(data stored in ACNUC30630 zone)

EMBL: AP009044.PE267

AP009044.PE267       Location/Qualifiers
FT   CDS_pept        273087..274805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0253"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53216"
FT                   /db_xref="GOA:A4QAG9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAG9"
FT                   /protein_id="BAF53216.1"
FT                   /translation="MMAALFVYIMAIPVIMMIKDAVTVQPADGVKTGQGPGELTSYYLW
FT                   RTLRSPVSVDLFWRPLGNTLSIALVVIFLTLIFGTFLALLVQKSNVYGRKWFATALIIP
FT                   YVLPSWTFALAWQTIFTNRTTGGQSGWLENAGLNPPDWLAYGRIPMIIIFTLHYGPLVF
FT                   LLISNSLSRIDSRNEEAALNAGADRLTVLWKITLPLLRPAILSASTLVLAKSIGEFGAA
FT                   YVIGLPVNFSVLSTSLYQSINTRQTGVAAVLAGALILIGAIGLFADYLFLRNARKYVTI
FT                   TGKGNSSRVNPLGSWRIPATALVGLAFATSVLLPLGTLLLSTIMRYPGNFELSNFTLDY
FT                   WIGHNLPTQAFRDGLLINSKLWSALWNTVWIAAIAAAAAALMGMLTGYAVTRTTSSPLA
FT                   NLLKQLAFIPYLVPGISFAVAYLSLFAVQRGPIPPLYGTTFILILILAADEVPFASRSG
FT                   ISSMMQLGKESEEASLNAGASWGRTIAMIVLPIQKSALAAAFVLPFISATQALSPVIIL
FT                   ATSETNLLTTLSMNLVDYGYTHAANGVTLMICLVALLGMVITRKVLKVDMGKGIS"
     atgatggctg cgctttttgt gtacatcatg gcgatccctg tgatcatgat gatcaaggat        60
     gctgtcactg ttcaacccgc cgatggtgtg aagacggggc aggggccggg cgaactgacc       120
     agttattatc tgtggcgcac tttacggtcg ccggtgtcgg tggatctgtt ttggcgtccg       180
     ttgggaaata cgctttcgat cgccctcgtg gttatttttt taaccctcat atttggaacg       240
     ttcctagctc tgttggttca aaagtccaac gtctatggca ggaagtggtt cgccaccgcg       300
     ctgatcattc cgtatgtgct tccaagctgg acttttgcgc ttgcatggca gacgattttc       360
     accaaccgca ccaccggagg acagtccgga tggctggaaa acgctggtct taatccgccg       420
     gattggctcg cgtatggccg gattcccatg atcatcatct tcacgctcca ctacggaccg       480
     ttggtgtttt tgctgatcag taactctttg tcgaggatcg atagccgaaa tgaagaagcc       540
     gcgcttaatg ccggtgcgga tcgtctgacc gtgttgtgga aaataacgct cccgctgctg       600
     cgtcctgcga ttttgtcggc gtccacgctg gtgctggcta aatcgatcgg tgaattcggt       660
     gcagcatatg taattggtct tccggtgaac ttctcagtgc tttcgaccag cttgtatcag       720
     tcgattaaca ccaggcagac cggtgttgcc gctgtgttgg cgggtgcgct gatccttatt       780
     ggtgcgatcg gattgtttgc ggactatttg ttccttcgaa atgctcgcaa atatgtcacc       840
     atcacgggta agggaaatag ctctcgggtg aatcctttgg gatcgtggcg tatccccgca       900
     actgcgctgg taggactggc ttttgctacc tctgttctgc tgcctttggg cacgctgttg       960
     ctgtccacca tcatgcgtta cccgggcaat ttcgagctgt ctaatttcac gctggattat      1020
     tggatcggcc ataacctacc cacccaagca ttccgcgacg gtttgttgat taacagcaaa      1080
     ctgtggtcgg cgctctggaa caccgtgtgg attgcagcaa ttgccgcggc agccgctgcg      1140
     ctgatgggca tgctcacggg atatgcagtc accagaacta cctcatcacc tttggcgaat      1200
     ctgctgaaac aactagcgtt catcccatat ttggtgcccg gcatttcctt cgccgttgcg      1260
     tatctttccc tcttcgcagt gcaacgcggc cccattccac cgttgtacgg aaccactttt      1320
     attctcattt tgatcctggc agccgatgaa gttcccttcg cctcccgctc cggcattagt      1380
     tccatgatgc agcttggtaa agaatcggaa gaggcatcac tgaacgctgg cgcatcgtgg      1440
     ggaaggacca tcgccatgat tgttctgccc atccaaaaat ctgctctagc tgcagctttc      1500
     gtccttccgt tcatctctgc gacgcaggca ttgtcacccg tgatcattct ggccacatcg      1560
     gaaaccaacc tgctgaccac gctgtccatg aacctcgttg attacggata cacccacgca      1620
     gccaacggag tcaccttgat gatctgcctc gtggcacttc tcggaatggt gattacccgc      1680
     aaggtgctca aagtggatat gggcaagggg atttcatga                             1719
//

If you have problems or comments...

PBIL Back to PBIL home page