(data stored in ACNUC30630 zone)

EMBL: AP009044.PE27

AP009044.PE27        Location/Qualifiers
FT   CDS_pept        29651..30901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0027"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52988"
FT                   /db_xref="GOA:A4Q9U5"
FT                   /db_xref="InterPro:IPR012429"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9U5"
FT                   /protein_id="BAF52988.1"
FT                   /translation="MENTNVSSTEYEESEHEETEHEEPGKSPTHAKHARAIDLKPQKRI
FT                   EGLDIARGFALLGMITVHLIPWDIEIGVSVFHDLFSGRAAALFALLAGISLALITGGST
FT                   PHTGKKLRRDRIAVVTRGLILLIFGLALNSLTPGDISILPYYGVFFLVGSLLIGLHTRT
FT                   LAVLTGILIVAGPAVVHMALWVEGFDSVRSSTLPEFFTSPLNTVFSLLFIGFYPAATWI
FT                   TFVACGIALGRIDVQDLSVQIKLMFFGGLTAVCSALASEVIVYHFGVLDRIIEATPWEY
FT                   SDIMFALDYGGETVPGYSWWWLMVDNPHNNTPFSLLDAGGSAVFMVGLSLLASRVLAKE
FT                   LSPIAAAGSMTFTLYTAHLLALKIDHSELQIMWVCINITVAIVFAYFWKKHIGQGPLER
FT                   LISSASKSTARAVVPRV"
     gtggaaaaca caaatgtctc gtccacggag tatgaagaat cagagcatga agagacagag        60
     cacgaagagc cagggaaatc cccaacgcac gctaaacatg cgcgagcaat tgatctaaaa       120
     ccccaaaagc gtattgaagg gctggatatt gcacgtggtt ttgcactgct cgggatgatt       180
     actgtgcatc ttattccgtg ggatattgag ataggagtct cggttttcca tgatctcttc       240
     tcgggtcgcg ccgctgcttt gtttgccctt ttggcaggta ttagtttggc gttgatcact       300
     ggtggttcga ctccgcacac tggtaaaaag ctccggcggg atcggattgc tgttgttacc       360
     cgcgggttga ttttgttgat ttttggtctg gcgttgaatt ctttgacgcc gggggatatc       420
     agcattcttc cgtattatgg tgtgtttttc ctagtggggt cgctgctgat tgggctgcat       480
     actcgaactc tcgcagttct caccggcatt ttaattgttg ctggtccagc agttgttcat       540
     atggcgttgt gggttgaggg gtttgattcg gttcgctcat ctactcttcc tgagtttttc       600
     acttctcctt tgaataccgt gttttcgctg ttgtttattg gtttttatcc ggcggctacg       660
     tggatcacgt ttgttgcgtg tggcattgcg ttgggaagaa ttgatgtaca ggatctgtcg       720
     gtgcagataa agctaatgtt tttcggtggg ctgacagctg tgtgtagtgc gctggcttct       780
     gaggtgattg tgtatcactt tggcgtgctg gatcggatta ttgaggcaac gccgtgggag       840
     tattcggata tcatgtttgc cctggattat ggcggggaga cggtgccagg ttattcctgg       900
     tggtggttga tggttgataa tccgcacaat aacactccgt tttctttgtt ggatgcgggt       960
     ggttcggcgg tgttcatggt ggggttgtcg ctgcttgctt cgcgggtgtt ggcaaaggaa      1020
     ctgagcccga ttgctgctgc gggttcgatg acattcacgt tgtatacggc tcatttgctg      1080
     gcgttaaaga ttgatcattc ggagttgcag attatgtggg tgtgtatcaa tatcactgtg      1140
     gccattgtgt ttgcgtattt ctggaagaag cacatcgggc aaggcccgct ggaacgcctc      1200
     atttcttcgg cgtctaaatc aacggcgcgg gcggtggtgc ccagggttta a               1251
//

If you have problems or comments...

PBIL Back to PBIL home page