(data stored in ACNUC30630 zone)

EMBL: AP009044.PE275

AP009044.PE275       Location/Qualifiers
FT   CDS_pept        281268..281672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_5002"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_5002"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53224"
FT                   /db_xref="GOA:A4QAH7"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAH7"
FT                   /protein_id="BAF53224.1"
FT                   /translation="MTRKFRRLHDLGYFIIPFVEFLSIVAGYFLIKTAADEFGKLNFIG
FT                   TILVVRGVVSLFTGWPLLFARVNDFRWDAVYLVGGAVFLAFLFLGPKEMTVLGLVAMFA
FT                   GPGMLIAGFSYLSRRIIAYFVELRRLQPSD"
     atgactcgaa aatttagaag actccacgat ctcggatatt tcatcattcc gtttgttgaa        60
     tttttaagta ttgtggcagg atactttctt attaaaactg cagcggatga gtttggaaag       120
     cttaatttta tcgggacgat tctcgtagtc agaggggtcg tttccctgtt taccgggtgg       180
     ccacttctat tcgcaagagt gaatgatttt aggtgggatg cagtttacct tgtgggtgga       240
     gcggtatttt tagcattcct ttttctgggg ccaaaggaaa tgacagttct tggactggtg       300
     gcgatgtttg ctggtccggg aatgctaata gcagggtttt catatctgag tcgtcgtatt       360
     attgcgtatt ttgtggaatt gaggcggttg caacctagtg attaa                       405
//

If you have problems or comments...

PBIL Back to PBIL home page