(data stored in ACNUC30630 zone)

EMBL: AP009044.PE278

AP009044.PE278       Location/Qualifiers
FT   CDS_pept        284949..289481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0263"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53227"
FT                   /db_xref="GOA:A4QAI0"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAI0"
FT                   /protein_id="BAF53227.1"
FT                   /translation="MKPQGLYNPAHEHDACGVAFIADIHGRPSRSIVDRALEALRNIDH
FT                   RGAAGAEKNTGDGAGILMQIPDGFYREVSGIELPEAGEYATGIAFLPRGRMAMMDAQKE
FT                   IERIAKQEGADVLGWRMVPFDSRELGSMAEEAMPSFAQIFLTVPGKSGEDLDRVMFFIR
FT                   KRCERELGTTNGRDTVYFPSLSSRTIIYKGMLTTLQLEGFFEDLGDARLESAIAIVHSR
FT                   FSTNTFPSWPLAHPYRFVAHNGEINTVRGNENWMRAREALIKNDKLGNLSSVLPICTPE
FT                   GSDTARFDEALELLHLGGYSLPHAVAMMIPQAWEHNKTLSPELRDFYEYHSCLMEPWDG
FT                   PAALAFTDGRFVGAVLDRNGLRPGRITITDSGLVVMASESGVLDLREESVVKRTRVQPG
FT                   RMFLVDTAEGRIVEDEEIKQKLSEAQPYGEWIRDNFVHLDRLPQTRYNYMAHSRAVLRQ
FT                   RVFGITEEDVDLLLLPMARQGAEAIGSMGSDTPIAALSQRPRMLYDFFAQRFAQVTNPP
FT                   LDSIREKPVTSMYTLLGAQSDVLNPGPDAARRIRLESPIIDNHELATLINANAHGEWDS
FT                   FGAAVISGLYPVAHHGAGMKAAIARVRREVSEAIRNGKTLIVLSDRESDERMAPIPALL
FT                   LTSAVHQYLVQQRTRTQCSLVVESGDAREVHHLAMLIGFGADAINPYMAFETIDELRMK
FT                   GQLDDLSLDEASRNYIKAATTGVLKVMSKMGIATVSSYRGAQLADVTGLHQDLLDNYFG
FT                   GIASPISGIGLDEVAADVEARHRSAFLPRPEEHAHRELDLGGEYKWRREGEYHLFNPET
FT                   IFKLQHATRSGSYEIFKDYTRKVDDQSTRLGTIRGLFEFSTDRKPISVSEVEPVSEIVK
FT                   RFSTGAMSYGSISAEAHEVLAIAMNRLGGMSNSGEGGEDARRFDVEPNGDWKRSAIKQV
FT                   ASGRFGVTSHYLNNCTDIQIKMAQGAKPGEGGQLPPNKVYPWVAEVRITTPGVGLISPP
FT                   PHHDIYSIEDLAQLIHDLKNANPRARIHVKLVAEQGVGTVAAGVSKAHADVVLISGHDG
FT                   GTGASPLTSLKHAGGPWELGLAETQQTLLLNGLRDRIRVQCDGQLKTGRDVVIAALLGA
FT                   EEFGFATAPLVVEGCIMMRVCHLDTCPVGIATQNPDLRSKFTGKAEHVVNFFTFIAQEV
FT                   REYLAQLGFRSIDEAVGQAQVLRKRSGIPADSRAAHLDLSPIFHRPETPHFPTQDVRCT
FT                   KTQEHSLEKALDNAFIDKASDTITRAAAGVETSIVIDSSISNVNRSVGTMLGSAVSRVA
FT                   GAQGLPDGTITLNLQGCAGNSFGAFIPRGITINLTGDANDFVGKGLSGGKIVIKPSAQA
FT                   PKQLKNNPNIIAGNVLGYGATSGELFIRGQVGERFCVRNSGATAVVEGIGNHGCEYMTG
FT                   GRVLVLGPVGENFGAGMSGGIAYLANSPDLNQKINGELVDVVPLSADDLTWADELIARH
FT                   RELTGSETKLRAQDLVKIMPRDFQKVLNIIETAHAEGQDPAIKIMEAVS"
     atgaaaccac aaggactcta caaccctgcg catgaacatg acgcctgcgg tgtggcgttt        60
     attgcggata tccacggtcg ccccagccgc agcattgttg atcgtgcact tgaggcgctt       120
     cgcaacattg accaccgagg tgccgccggt gcagagaaga atactggcga tggtgcgggc       180
     atcctcatgc agattccgga tggcttttat cgtgaagtgt ctggcattga gcttcctgag       240
     gcaggggagt atgccactgg tattgcgttc ttgcctcgtg gtcgcatggc gatgatggat       300
     gctcagaagg aaattgagcg catcgcaaag caagagggcg cggatgtgct tggttggcgc       360
     atggttcctt ttgattcccg tgagctgggt tccatggctg aggaggctat gcctagtttc       420
     gcgcagattt tccttactgt gcctggaaaa tctggtgaag atcttgaccg tgtgatgttc       480
     tttatccgta agcgttgtga gcgtgagctg ggcaccacca atggtcgcga tactgtgtac       540
     ttcccgtcgc tatcttctcg caccatcatt tacaaaggca tgctgaccac tctgcagctt       600
     gagggtttct ttgaggattt gggtgacgct cgcctggagt cggctatcgc cattgtgcac       660
     tcgcgtttct ccacgaacac tttcccaagc tggccactgg cgcacccgta ccgtttcgtt       720
     gcccacaacg gtgagatcaa cactgtgcgt ggcaatgaaa actggatgcg cgcccgcgag       780
     gcgcttatca aaaacgacaa gctgggcaat ttgagcagcg tgctgcctat ctgcaccccg       840
     gagggctcgg ataccgcgcg tttcgacgag gctttggagc ttttgcacct gggcggatac       900
     tcacttccgc atgctgttgc gatgatgatc cctcaggcgt gggaacacaa caagacgctg       960
     agccctgagc tgcgtgattt ctatgaatac cactcttgtc tgatggagcc atgggatggt      1020
     cctgcagcgc tggcatttac tgacggtcgt tttgtgggtg ccgtgctgga ccgtaatggc      1080
     ctgcgacctg ggcgaatcac cattactgat tcgggtttgg ttgtgatggc ttctgaatcg      1140
     ggcgtgttgg acttgaggga ggagagcgtc gtaaagcgta ctcgcgtaca gcctggacgc      1200
     atgttccttg ttgacacggc cgagggccgc atcgttgaag acgaggaaat caagcagaaa      1260
     ttaagcgaag cgcagccata tggtgagtgg attcgcgata attttgtgca tctggatcgt      1320
     ctgcctcaga cacgctacaa ctacatggcg cactctcgtg ctgtgttgcg tcagcgtgtt      1380
     ttcggaatca ctgaagaaga tgtggatttg ttgctgctgc cgatggcccg ccagggtgct      1440
     gaggcaattg gttccatggg ttcggatacg ccaattgcgg cgctgtccca gcgaccacgc      1500
     atgctttatg atttcttcgc gcagcgcttt gcccaggtga ctaacccacc tttggactcc      1560
     attcgtgaaa agccagtgac cagcatgtat acgctgttgg gtgcgcagtc cgatgtgctg      1620
     aacccaggtc ctgatgctgc gcgacgtatc cgtttggaat cgccgatcat tgataaccat      1680
     gagctggcca ccctgatcaa cgccaatgcg catggtgaat gggattcctt cggtgctgcc      1740
     gtaatttctg gtctgtaccc agtggctcac catggtgctg gtatgaaggc agcaattgca      1800
     cgtgtgcgcc gtgaggtttc tgaagcaatc cgcaatggta agacgttgat cgtgctgtcg      1860
     gatcgtgaat ccgatgagcg catggcacct atccctgcgc tgctgctgac ttccgctgtg      1920
     catcagtact tggtgcagca acgtacccgt acccagtgct ccctggtggt ggaatctggc      1980
     gatgcccgcg aggttcatca cctggcgatg ctcattggtt ttggtgccga tgcgatcaac      2040
     ccgtacatgg cgtttgaaac catcgatgag ctgcgcatga agggtcagtt ggatgatctt      2100
     tctctggatg aggcatcccg aaactacatc aaggcagcca ccactggtgt gctgaaggtg      2160
     atgtccaaga tgggtatcgc tacggtgtct tcgtaccgtg gcgcgcagct tgctgatgtc      2220
     accggtctgc atcaggatct cctggacaac tacttcggtg gtattgcttc accaatttct      2280
     ggtatcggtc tggatgaggt tgcagctgat gtggaagctc gtcaccgcag cgcatttttg      2340
     ccacgcccag aagagcacgc tcaccgcgaa ttggatttgg gtggtgaata caagtggcgc      2400
     cgcgaaggtg aatatcacct gttcaaccca gaaacaatct tcaagctgca gcatgcaact      2460
     cgttctggca gctacgagat tttcaaggat tacacccgca aggttgatga tcaatccact      2520
     cgcttgggta ctattcgtgg attgtttgag ttcagcacgg accgcaagcc aatttcggtg      2580
     tctgaggtgg agccggtcag tgagatcgtg aagcgtttct ccactggtgc gatgtcttat      2640
     ggctcgattt ctgctgaagc ccacgaggtc ttggccatcg ccatgaaccg actgggcggt      2700
     atgtccaact ccggcgaagg tggcgaggac gcccgccgat tcgatgtgga acccaacggt      2760
     gactggaagc gctctgccat caagcaggtg gcatcgggac gtttcggcgt gaccagccac      2820
     tacctgaaca actgcaccga tatccagatc aagatggcac agggcgcaaa gcccggtgaa      2880
     ggtggtcagc taccaccaaa caaggtgtac ccatgggttg cagaagtccg catcaccacc      2940
     ccaggcgttg gcctgatttc ccctccacca caccacgata tttactccat tgaggatctg      3000
     gctcagctga tccacgacct gaagaacgct aacccacgcg cacgaatcca cgtgaagcta      3060
     gtggcagaac aaggcgtggg caccgttgcc gcaggtgtgt ccaaggcaca cgctgatgtg      3120
     gtgcttattt ccggccacga cggcggaact ggcgcatctc ctttgacctc cctgaagcat      3180
     gccggtggtc catgggagtt gggcttggct gaaacccagc aaacgttgct gctcaacggc      3240
     ctgcgtgatc gtattcgcgt gcagtgcgat ggtcagctga aaactggccg agacgtagtt      3300
     atcgcagctc tgctcggtgc ggaagaattc ggtttcgcca ccgcaccgct ggtggttgaa      3360
     ggctgcatca tgatgcgcgt ctgccacctg gacacctgcc cggtgggtat cgctacccag      3420
     aacccggatt tgcgttccaa gttcaccggc aaggctgaac acgtggtcaa cttcttcacc      3480
     ttcatcgccc aggaagtccg tgagtacttg gcacagcttg gtttccgctc tattgatgaa      3540
     gccgtcggac aagcccaggt gctgcgtaag cgttccggaa tcccagctga ttcccgggca      3600
     gcacacctgg atttgagccc aattttccat cgcccagaaa ctccacactt cccaactcag      3660
     gatgtgcgtt gcaccaagac ccaggaacac agcctagaaa aagccctgga caacgcattt      3720
     attgataagg cttcggacac gatcacccgt gccgcagcgg gtgtggaaac cagcattgtt      3780
     attgatagct ccatcagcaa cgtcaaccgt tcagttggca cgatgctggg ttctgcagtc      3840
     agccgcgtgg ctggtgccca aggtttgcca gacggcacca tcaccttgaa tcttcaaggc      3900
     tgcgccggta actcctttgg cgcgttcatc ccacgaggca tcaccatcaa cctcaccggc      3960
     gatgccaatg actttgtggg caagggatta tctggcggaa agattgtgat caagccttcc      4020
     gctcaggctc cgaagcagct gaagaacaat ccaaatatca ttgccggaaa cgtgcttgga      4080
     tacggcgcaa ccagtggtga attgttcatt cgtggccagg tcggcgaacg tttctgcgtc      4140
     cgtaactctg gcgccaccgc agtggttgaa ggtattggaa accacggttg tgagtacatg      4200
     actggcggcc gagtcctggt tttgggcccg gttggtgaga actttggtgc cggcatgtct      4260
     ggtggcattg catacctggc taattccccg gacctaaacc agaagatcaa tggcgaattg      4320
     gtggatgttg ttccactgag cgctgacgat ctgacgtggg ctgatgagct cattgctcgc      4380
     caccgcgaac tcaccggatc cgagaccaag ctgcgtgcac aagatttggt gaaaatcatg      4440
     ccgcgcgatt tccaaaaagt actcaacatc atcgaaacgg cccacgctga gggccaagac      4500
     ccagcaatca agatcatgga ggcagtgagc taa                                   4533
//

If you have problems or comments...

PBIL Back to PBIL home page