(data stored in ACNUC30630 zone)

EMBL: AP009044.PE281

AP009044.PE281       Location/Qualifiers
FT   CDS_pept        complement(292902..296375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0266"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53230"
FT                   /db_xref="GOA:A4QAI3"
FT                   /db_xref="InterPro:IPR007680"
FT                   /db_xref="InterPro:IPR027451"
FT                   /db_xref="InterPro:IPR032731"
FT                   /db_xref="InterPro:IPR040920"
FT                   /db_xref="InterPro:IPR042486"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAI3"
FT                   /protein_id="BAF53230.1"
FT                   /translation="MSNSSPNDPSPMRQVGGNGGHQLDSINVSDVVESKKLKGSAQEPP
FT                   QVAPGWLKKLAISSGLLGLLMFVLLPFLPVNQVQSSLSWPQNGELSSVNAPLISYAPQS
FT                   MDASIPVSALDSLNDNQSLVMGTLPLDSTDATNRGLFVRTIDGNLDVIVRGEVLLDLSP
FT                   TEVNRLPDDAILEISSTEETTSAEITGTAFSGETEGDERPQVTGVYTELVDDPSTASAL
FT                   ASAGLKVDIEINSRFTSSPSLLKYAAIFIGLASVLVSLWALHRMDILDGRKAHRFLPAN
FT                   WYKLKPLDGVVVAILVFWHFIGANTSDDGFIMNMARVSQNADYMANYYRWFGVPESPFG
FT                   APYYDLLALMAYVSTSSIWLRLPALLAGLIMWFVITREVMPRFGSLVNGRRVAHWSAAM
FT                   VFLAFWLPYNNGTRPEPIIAMGALLAWVSFERAIATSRLLPAAIGVIIATISLASGPTG
FT                   LMAVAALLVSLSALIRILYRRLPLIGAPRGASKSKVFGASMAMLSPFLASGTAILIAVF
FT                   GDQTLSTVMESISVRSAKGPSLTWYHEYVRYQTVMEQTVDGSFTRRFAVLILMACLAIV
FT                   VIAILRYGRIPGAAKGPSLRLMMVIFGTMFFMMFTPTKWTHHFGVYAGLAGALAGLAAV
FT                   GLSYVAVKSPRMRTISIGAFLFLLALALAGVNGFWYTSSYSVPWWDKTIQIKGIEASTV
FT                   VLVIAVIVLIIGVIQSFVHDVKTAQAETNHSMGELVAEDEAKRERASRFTGLAASPIAG
FT                   VSALVVLITCASMGKGFVDQYPAYSVGLGNLRSLTGNTCGLASDAMLETNSNDSFLTPV
FT                   NSTLGESLESEDIRGFSASGIPPSISQDQANLSQVGAIANTDDSTETGGSDESSGQSTG
FT                   NTGGVRGSEGINGSNARLPFNLDYTQVPVVGSWSAGTQNPANITTDWYEIPEATEEAPI
FT                   IVVSAAGRIEHYDINGVHQSGQSVVLEYGRLRDNGDVEDLGEAMMYDIGPEPSWRNLRY
FT                   PLDQLPEEADVVRIVATDVNLDEDQWVALTPPRVPNLDSLNNVIGSETPGLLDWAVGLQ
FT                   FPCQRTFDHYAGVTEIPEYRISPDHGGKSTLSPFQDWAGGGSMGTAEAVNNAYEIPSYL
FT                   RNDWGRDWGSIERYSLRTNSNGDAPKVADINLETIQRSGLWNPGHMKVDE"
     atgagtaatt cctcaccaaa cgacccaagc cctatgcgcc aagtcggtgg taatgggggc        60
     catcaactag actcgatcaa cgtgtcagat gtagttgagt cgaagaaact aaagggttct       120
     gcgcaagaac ccccgcaggt tgccccgggc tggctgaaga aactggctat ctcatcaggt       180
     ctgcttggcc tgttgatgtt tgtgctgttg cctttcctgc cagtgaacca ggtgcagtct       240
     tcgctgtcat ggccacaaaa tggtgagctt tccagcgtta acgccccgct gatttcctac       300
     gcaccgcagt cgatggatgc gtccatccct gtgtccgcgc tggacagtct caatgacaat       360
     cagtcgttgg tgatgggcac gttgcctctg gatagtacgg acgccaccaa ccgtggtctg       420
     tttgtgcgca ccatcgacgg caaccttgac gtgattgttc gcggtgaggt gctgttggat       480
     ctttcaccaa cagaggtgaa ccgtctgcca gatgatgcga tcctggagat ttcctccacc       540
     gaggaaacca ccagcgcaga aatcaccggc acggcattca gcggcgagac cgaaggcgat       600
     gagcggcctc aggtcaccgg cgtttacacc gagcttgtcg acgacccctc caccgcatcg       660
     gccctggcct cagcgggctt aaaggttgat attgagatca actcccgctt cacttcatcc       720
     cccagccttc ttaagtacgc agccatcttc attggtcttg cgtctgtatt ggtctccctg       780
     tgggcactgc accgtatgga cattttggat gggcgaaaag cacaccgctt cctgcctgcc       840
     aactggtaca agctgaagcc tcttgatggt gttgtcgtag cgattttggt gttctggcac       900
     ttcattggcg ccaacacctc tgacgacggc ttcatcatga acatggcccg ggtgtcccag       960
     aacgcggact atatggccaa ctattaccgc tggttcggtg tccccgaatc accattcggc      1020
     gcgccatatt acgacttgct ggctctgatg gcctacgtct caacctcatc aatctggctt      1080
     cgactacccg cattgctcgc tggactgatc atgtggttcg tgatcaccag agaggtcatg      1140
     ccacggtttg gctcattggt taacggtcgc cgcgttgcgc actggtctgc agccatggtg      1200
     ttcctggcgt tctggcttcc atacaacaac ggcactcgcc cagagccaat catcgcgatg      1260
     ggagctctac ttgcgtgggt ttccttcgag cgcgctatcg ctacctccag gttgttaccc      1320
     gctgccattg gtgtcattat cgccaccatt tccctggcat caggccccac cggtctgatg      1380
     gcagttgctg cgttgctggt cagtttgtcc gcgttgattc gcattcttta taggcgcttg      1440
     ccgcttattg gggcgccgag gggcgcgtcg aaaagcaaag tctttggcgc ttctatggct      1500
     atgctctccc cattcctggc gtctggtacc gcgattctca tcgctgtttt tggcgatcag      1560
     acgctgtcaa ccgtcatgga atccatcagc gtgcgctccg cgaaaggtcc atcactgacc      1620
     tggtaccacg aatatgtgcg ctaccaaacc gtcatggaac aaaccgttga cggttccttt      1680
     acccgccgtt tcgctgtgct aatcctcatg gcatgcctgg ctattgtggt catcgcgatc      1740
     ctgcgctacg gccgcattcc tggcgccgct aagggaccat ccctgcgcct gatgatggtc      1800
     attttcggca ccatgttctt catgatgttc accccaacca agtggaccca ccacttcggt      1860
     gtctacgcag gtcttgccgg tgcgctggcc ggacttgctg ccgtgggact atcctatgtt      1920
     gcagtaaaat caccacgcat gcgcaccatt tccatcggcg cgttcctctt cctgctggcg      1980
     ctggcgctgg caggcgtgaa cggattctgg tacacctcca gttattccgt gccatggtgg      2040
     gataaaacca tccaaatcaa gggcatcgaa gcatccaccg tggtgctcgt gatcgctgtg      2100
     atcgtgctga tcatcggtgt tatacagtcc ttcgtccacg atgtgaaaac cgcgcaagcc      2160
     gaaaccaatc actccatggg cgaactcgtg gcggaagatg aagcaaagcg cgagcgtgcc      2220
     tccaggttca ccggccttgc ggcctcccct atcgcaggag tgtccgccct cgttgtgctg      2280
     attacctgcg catccatggg caaaggcttt gtggaccaat accccgcgta ctccgtgggt      2340
     cttggcaacc tccgctccct gaccggcaac acatgtggcc ttgcctccga cgccatgctg      2400
     gaaacaaact ccaacgattc cttcctcact ccagtgaact ccacacttgg tgagtccctg      2460
     gaatccgagg acatccgagg attcagcgcc tccggcatcc caccatcaat cagccaagac      2520
     caggcaaacc tctcccaagt cggtgccatt gccaacactg acgactccac cgaaaccggc      2580
     ggatccgacg aatcatccgg acaatccacc ggcaacaccg gcggtgtccg aggctccgaa      2640
     ggcatcaacg gctccaacgc ccgcctgcca ttcaacctgg actacaccca agttccagtc      2700
     gtcggctcct ggtccgctgg cacccaaaac ccagcaaaca tcaccaccga ctggtacgaa      2760
     atcccagaag ccaccgaaga agcacccatc atcgtggtat ctgcagcagg tcgcatcgaa      2820
     cactacgaca tcaacggcgt ccaccaatcc ggacaatctg tcgtgctcga atacggtcgc      2880
     cttcgcgata acggcgacgt tgaagacctc ggcgaagcca tgatgtacga cataggcccc      2940
     gagccatcct ggcgcaacct ccgctaccca cttgaccaac tcccagaaga agcagacgtc      3000
     gtgcgcatcg tcgccaccga cgtcaacctc gacgaagacc aatgggtagc actgacgcca      3060
     ccacgcgtac ctaacctaga ttctctgaac aacgtcatcg gatccgaaac cccaggactc      3120
     ctcgactggg cagttggcct gcaattccca tgccaacgca ccttcgacca ctacgccgga      3180
     gtcaccgaga ttcctgaata ccgaatctcc cccgaccacg gcggaaaatc caccctctcc      3240
     ccattccaag actgggcagg cggcggatcc atgggcacgg ccgaagcagt aaacaacgcc      3300
     tacgaaatcc cgtcctacct ccgcaacgac tggggccgcg actggggttc catcgaacgc      3360
     tactccctgc gcaccaactc caacggcgat gcacctaagg ttgcagacat caaccttgaa      3420
     accatccaac gttccggact atggaatcca ggacatatga aggtagatga ataa            3474
//

If you have problems or comments...

PBIL Back to PBIL home page