(data stored in ACNUC30630 zone)

EMBL: AP009044.PE283

AP009044.PE283       Location/Qualifiers
FT   CDS_pept        complement(298571..299332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0268"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53232"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAI5"
FT                   /protein_id="BAF53232.1"
FT                   /translation="MLNAVGKAQNILLLGGTSEIGISIVSRFLKQGPSHVTLAARKDSP
FT                   RVDAAVAEIKAAGAASVTVVNFDALDTESHPAAIDAAFENGDVDVAIVAFGILGDNEAQ
FT                   WRDQALAVEATTVNYTAGVSVGVLLGQKFEQQGHGTIVALSSVAGQRVRRSNFVYGSAK
FT                   AGFDGFYTQLGEALHGSGANVLVVRPGQVRTKMSADGGEAPLTVNREDVADAVYDAVVN
FT                   KKDIIFVHPLFQYVSFAFQFIPRAIFRKLPF"
     atgcttaacg cagtgggcaa agcccaaaac attctccttc ttggtggaac ctctgagatc        60
     ggtatttcca ttgtctcccg cttcctcaag cagggtccat cccatgtgac cttggcagcg       120
     cgtaaagatt ccccacgcgt ggacgcagca gtcgcagaga tcaaagcagc tggcgctgct       180
     tctgttactg ttgttaattt cgatgcgctc gacaccgaat cccaccctgc agccatcgac       240
     gcagcctttg aaaacggcga cgttgacgta gcaatcgtgg ctttcggcat cctcggcgac       300
     aacgaagcac agtggcgcga ccaagcacta gccgtggaag caaccaccgt gaactacacc       360
     gccggcgttt ccgtaggtgt actgctgggc cagaaatttg agcagcaggg ccacggcacc       420
     atcgtggcat tgtcctctgt ggcaggccag cgagtccgcc gctccaattt tgtctacggc       480
     tccgccaagg caggtttcga cggtttctac acccagctcg gcgaagctct tcatggctcc       540
     ggcgctaacg tattggtggt tcgcccaggc caggtacgca ccaagatgtc cgcagatggt       600
     ggcgaagccc cactgaccgt caaccgcgaa gacgtcgcag atgctgttta tgatgcagtg       660
     gtgaacaaga aggacatcat ctttgtccac ccactgttcc agtacgtctc ttttgcgttc       720
     caattcatcc cgcgggcaat cttccgcaaa ctgccgttct aa                          762
//

If you have problems or comments...

PBIL Back to PBIL home page