(data stored in ACNUC30630 zone)

EMBL: AP009044.PE289

AP009044.PE289       Location/Qualifiers
FT   CDS_pept        303040..303474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0274"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0274"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53238"
FT                   /db_xref="GOA:A4QAJ1"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAJ1"
FT                   /protein_id="BAF53238.1"
FT                   /translation="MPENPDVTIVRPMSLKTQAFRFILTGGLSAIVDLGLLSLLQLVFG
FT                   LPVPVARTISFIAGTTTAYMINRRWTFQAESSTSRFLAVVALYGVTFLINIGLQTLCSA
FT                   LFENWGWNEAVAMVCAFVIAQGTGTVINFIVQRTIIFRVK"
     gtgcccgaaa atcctgatgt tacgatcgtc cgaccaatga gcctgaaaac ccaagctttc        60
     cggttcatcc tcaccggtgg cctctcagcc atcgtggacc tcggcctgct gtcacttttg       120
     cagctagtgt tcggccttcc cgtacctgtt gcccgcacga tctccttcat cgccggcacc       180
     accaccgcct acatgatcaa ccgccggtgg accttccaag cagaaagctc cacctccagg       240
     ttccttgccg tggtggccct ctacggcgtg accttcctga tcaacattgg actgcaaacc       300
     ctctgctccg cattgtttga gaattggggc tggaacgaag ccgtcgcgat ggtgtgcgcc       360
     ttcgtgatcg cccaaggcac cggaacagtc atcaacttca tcgttcaaag aaccatcatt       420
     ttccgagtga agtaa                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page