(data stored in ACNUC30630 zone)

EMBL: AP009044.PE297

AP009044.PE297       Location/Qualifiers
FT   CDS_pept        complement(309662..310618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0282"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53246"
FT                   /db_xref="GOA:A4QAJ9"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAJ9"
FT                   /protein_id="BAF53246.1"
FT                   /translation="MQAIVQTEEKVTASLELQEVPVPTLKPGEVLVEVKAAGVNRADLL
FT                   QTQGNYPVPAGASEILGLECAGVIVDAGDTGQTVGQEVACLLTGGGYAEYVAVPEGQLM
FT                   PIPEGYSFVEAASIVEVACTVWSNIGMLAGLQKEDTFLIHGGAGGIGTFAIQMGKALGV
FT                   TVAVTAGSTEKLKTCKNLGADILINYKEEDFAEVLKNKADVILDIIGAKYLSQNVKAMA
FT                   KDAHMVVIGMQGGVKGELNLGHLLAKRGTISATALRGRDEADKARIVSSTVENIWPLLQ
FT                   SKEITPHIDHTLPLAEAAAALQKIQDGTITGKLVLTV"
     atgcaagcca tcgtccaaac tgaggagaag gtcactgctt ctctggaatt acaggaagtc        60
     cccgtcccga ccctgaagcc aggtgaggtg ttggtggagg tgaaggctgc gggcgttaac       120
     cgtgcggatc ttttgcagac gcagggaaat tatcctgtgc cggcgggggc ttcggagatt       180
     ctcgggctgg aatgtgcggg tgtgatcgtg gatgccggcg acactgggca aacagtgggt       240
     caggaagtcg cttgccttct cactggcggt ggatatgcgg aatatgtggc ggttccggaa       300
     ggtcagttga tgccaattcc agagggttac agctttgtgg aggcggcctc gatcgtggag       360
     gttgcgtgca cggtgtggtc gaatatcggc atgctggcgg gcttacagaa ggaggatact       420
     ttccttattc atggcggcgc gggcggtatc ggaacgtttg ccattcagat gggcaaggct       480
     ctgggtgtga cggttgcggt gactgccggt tcaactgaaa agttaaaaac ctgtaagaac       540
     ttaggggccg atatcctcat caattacaag gaggaagatt tcgccgaggt tttgaagaac       600
     aaggcggatg tcattctcga tattattggc gcgaagtatt tgtcacagaa tgtgaaggcg       660
     atggccaagg acgcgcacat ggtggtcatc gggatgcagg gtggcgtgaa aggggagctg       720
     aatttgggtc atcttttggc caagcgaggc acgatttctg ccactgcgct gcgtggtcgc       780
     gatgaggcgg ataaggctcg gattgtcagc agcactgtcg aaaatatttg gccgctgctg       840
     caatcgaagg aaattacccc tcacatcgac cacaccttgc cgctagccga agcagccgcc       900
     gccttgcaga aaattcaaga cggcaccatc accggcaagc tcgtgcttac ggtttag          957
//

If you have problems or comments...

PBIL Back to PBIL home page