(data stored in ACNUC30630 zone)

EMBL: AP009044.PE305

AP009044.PE305       Location/Qualifiers
FT   CDS_pept        complement(316268..316729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0289"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0289"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53253"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAK6"
FT                   /protein_id="BAF53253.1"
FT                   /translation="MTALVIVASTRAAAGVYEDRSGPILVSWLRAKGFDTPDPVIVADA
FT                   DLPAFLDELKFPQVVLISGGTGLTPDDITVDTLIPRLDKEIPGIAHAFWNYSMDAVPTA
FT                   VLSRTVAGTIGSSFIMALPGSTGAARDATAVLDPLIDHITGTLQGHHEH"
     gtgacagctc tggttatcgt tgcgtccact cgcgccgctg cgggggtgta tgaggatcgc        60
     tctggcccaa ttttggtgtc gtggctgcgt gcaaaaggtt ttgacacacc cgaccccgtg       120
     atcgtggcgg acgccgacct gcccgcattc ctggacgagc tgaagtttcc gcaggtagtg       180
     ctcatttcag gcggcaccgg actcacgcct gatgacatca ccgtggacac tttaatcccg       240
     cgcctcgaca aagaaatccc cggcatcgcc cacgcttttt ggaattacag catggacgcc       300
     gtcccgaccg cagtattgtc gcgcaccgtc gcgggcacca tcggcagcag tttcatcatg       360
     gcactgcccg gctccacggg tgcggcgcgc gatgccacgg ctgtcctcga cccgctcatt       420
     gatcacatca ctggaactct gcaaggccac catgaacact ga                          462
//

If you have problems or comments...

PBIL Back to PBIL home page