(data stored in ACNUC30630 zone)

EMBL: AP009044.PE314

AP009044.PE314       Location/Qualifiers
FT   CDS_pept        323698..325008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0298"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53262"
FT                   /db_xref="GOA:A4QAL5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAL5"
FT                   /protein_id="BAF53262.1"
FT                   /translation="MKELDLGEAHGVAATLEAMPIQEVIDQVERTPIAEGAVLLRLLSK
FT                   DRSLLVFDALNPRLQADLIGAFQDAEVLDYFADLDPDDRVSLLDELPASIADELLRSLD
FT                   PQAKQVTELVLGYAKRSVGRWMSPQVLLLYDDMSVAEVLDYVRNHAAEAETIYALPIVN
FT                   RARQVVGVVSLRKLFIADPALKVSEVMVRPVSVLASADAEETARWFLQLDLVAMPVVDE
FT                   SDMLVGVLTFDDAQDIVEQAESEDSARSGGSEPLQQPYLSTPIRKLVKSRIVWLLVLAV
FT                   SAILTVQVLDVFEATLAEAVVLALFIPLLTGTGGNTGNQAATTVTRALALGDIRKSDVF
FT                   RVLGREIRVGLMLGALLGGVGFVIASLVYGMPVGTVIGLTLLAVCTMAASVGGVMPIIA
FT                   KAIGADPAVFSNPFISTFCDATGLIIYFAIAKLVLGI"
     atgaaggaat tggatctggg tgaggctcat ggcgttgctg caacgttgga ggccatgccg        60
     atccaggagg tcattgatca ggtagagcga accccgattg ctgaaggtgc ggtgctgctg       120
     cgccttttga gtaaagatcg gtcgttgttg gttttcgatg ccctaaatcc ccgactccag       180
     gctgatttga ttggtgcgtt ccaggatgcg gaagtgttgg attatttcgc tgatcttgac       240
     cctgatgacc gcgtttcact gcttgatgag ctgccggcgt cgatagccga tgagctgctg       300
     cgcagccttg acccgcaggc taagcaggtt acggaactgg tcctgggtta cgcaaagcgg       360
     tcggttgggc gttggatgtc gccccaggtt ttattgcttt acgacgacat gtccgtcgct       420
     gaagtcttag actatgtgcg taatcatgct gctgaggctg aaacgattta tgccttacct       480
     attgtgaacc gtgctcgaca ggttgtcggc gtggtgtcgt tgcgaaagct gttcattgcg       540
     gatcctgcat tgaaagtttc agaggttatg gtacgcccgg tttccgtttt ggcttccgcg       600
     gatgcggagg aaacagctcg ctggtttttg cagctggacc ttgtcgcgat gcctgtggtg       660
     gatgagtccg acatgcttgt tggcgtgctg accttcgatg atgcgcaaga cattgtggag       720
     caagcagaat cagaagactc tgcgcgtagt ggtggttccg agcctctcca gcagccgtat       780
     ctttccacgc caattcgtaa gctggtgaaa tcgcgcatcg tatggcttct ggttttggct       840
     gtgtcggcaa ttttgacggt tcaagttctt gatgttttcg aggccacctt ggccgaagct       900
     gtggtcctgg cactgttcat tccgctgctc actggcacgg gtggaaacac gggaaatcag       960
     gctgcaacaa cagtgactcg tgcgttggct ttgggtgata ttcgaaaatc tgatgtcttc      1020
     cgcgtcttgg gtagagaaat ccgagtcggc ctcatgctcg gggcattgtt gggtggcgtt      1080
     ggatttgtga tcgcatcgct tgtttacggc atgcccgtag gcactgtcat cggtctgaca      1140
     ttgttggcgg tgtgcacgat ggccgcatca gttggcggag taatgccaat tattgccaag      1200
     gcgatcggag cggacccagc ggtgttctct aatcctttta tttcaacctt ctgtgatgca      1260
     acaggtttga tcatctactt tgcaattgcc aagttggtgc tcggaatcta a               1311
//

If you have problems or comments...

PBIL Back to PBIL home page