(data stored in ACNUC30630 zone)

EMBL: AP009044.PE327

AP009044.PE327       Location/Qualifiers
FT   CDS_pept        complement(338337..339344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0311"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53275"
FT                   /db_xref="GOA:A4QAM8"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAM8"
FT                   /protein_id="BAF53275.1"
FT                   /translation="MAEQLRQFEGRVLPNQSEDLEDQGLGFDLGTVFSRRKVLGFIGVG
FT                   GAGVALAACSPSGSSAASSTSSASSSAAATSSAAAETLTEMKSETAGPYPGDGSNGPDV
FT                   LEVSGVERQDITKSIDTDTVAEGVPLTLTMTILDMNNNNQPMEGAAVYIWHCDAPGRYS
FT                   MYDDELLEETYLRGVQITDKYGQVTFDTIFPGCYAGRWVHIHFEVFPDRESISDSTNNI
FT                   LTSQIALDEASAASVYALDVYGDSLTNLNNITLESDNVFSDGWDQQMANLTGDATSGFI
FT                   ASIDVPIDPTTEQDQSMNMPSGGGMGGGPSGGGMGGPGEGMTPPDGMTPPSEPQ"
     atggctgagc agttgcgtca atttgaaggc agggtcctcc ctaatcaatc cgaggacttg        60
     gaagatcagg gtctgggttt tgacctaggt accgttttct cccgcaggaa agttttgggc       120
     ttcattggtg ttggtggagc gggtgtggct cttgctgctt gctctccttc tggttcttca       180
     gcagcatcca gcacctcaag cgcctccagt agcgcagcgg caaccagcag tgcagcggct       240
     gagactttga ctgagatgaa gtcggagact gctggtccgt acccgggcga tggttcgaac       300
     ggtccagatg ttctggaggt ctctggtgtg gagcgtcagg acatcaccaa gtccattgac       360
     actgacactg tggcagaggg cgtgccactg acgttgacca tgaccatttt ggacatgaac       420
     aacaacaatc agccgatgga gggtgctgcg gtttacattt ggcattgtga tgcgccgggt       480
     cgttactcga tgtatgacga tgagctgctg gaggagactt accttcgtgg tgtgcagatc       540
     accgataagt atggtcaggt cacgttcgat accatcttcc ccggttgcta tgcgggtcgt       600
     tgggtgcaca ttcactttga ggttttccct gatcgtgaga gcatttcgga ttctacgaac       660
     aacattttga cgtcgcagat tgcgctcgat gaggcttctg cagcatctgt ctatgcactt       720
     gatgtgtacg gagattcgtt gacgaacctg aataacatca cgttggagtc ggacaatgtc       780
     ttctccgatg gttgggatca gcagatggct aacctgactg gtgatgctac cagcggtttc       840
     attgcttcca ttgacgtccc gatcgatccg acgactgagc aggatcagtc gatgaacatg       900
     ccaagtggtg gcggaatggg tggaggccca agtggcggtg gaatgggtgg cccaggagag       960
     ggtatgaccc ctccagatgg aatgacccct ccctctgagc ctcagtaa                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page