(data stored in ACNUC30630 zone)

EMBL: AP009044.PE335

AP009044.PE335       Location/Qualifiers
FT   CDS_pept        352269..353720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0319"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0319"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53283"
FT                   /db_xref="GOA:A4QAN6"
FT                   /db_xref="InterPro:IPR007349"
FT                   /db_xref="InterPro:IPR012429"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAN6"
FT                   /protein_id="BAF53283.1"
FT                   /translation="MTSHLEEKQVRVLEGDLPVDVRPHSGWSEERSVWTGHGDEAQPIK
FT                   FGTTAVGTYRAEEEYGAERQWSKGRIIGINVARGLALFGMFSVHTLDPWNEEAERVTVL
FT                   WMMTAGNAAALFAVLAGVGIALSTGGSKGLRPERRINARVQLFVRALLILFIGLLSNLW
FT                   LDPPVFNILPYYAVLFLLASLFLGVRKRTLCTWALLMMLAGPIAQYFVRSAEPYERILS
FT                   PVPADLISNPADVLGTLLFTGTYPVTTWSAYMLVGLALGRMQLNRIQVQLGLFGFGAFA
FT                   AVSGWLMSRMAVNFLGGYEGMLYSEVRITQEMVEAFLTEGPDEDLPTSSFWWLTVAGPH
FT                   TNTFFSLLLSTGVAVSVLGATFLICRVFPRLLWPLAAAGSMTLTLYVCHMAFLHFYAIG
FT                   DYSTDQELNLALAIQILGVLIISGLWSLLFRRGPLEWLVGELSKRIADPRRKSAETGGA
FT                   LKSGSRGMTGSGWWRHRAVSGRHRM"
     atgacgagcc atttggaaga gaaacaggtg cgagtcctgg aaggagacct tccggtagat        60
     gttcgacctc attctggctg gagtgaagaa cgttcggtat ggactggtca tggcgatgaa       120
     gcccagccga tcaagttcgg caccaccgca gtgggtacct atcgggcgga ggaagaatac       180
     ggtgccgaac ggcagtggag caaggggagg atcattggca tcaatgttgc acgtggtttg       240
     gccctgttcg gaatgttttc ggtgcacacc ctcgatccat ggaatgagga ggccgagcga       300
     gtcaccgtcc tgtggatgat gaccgcagga aatgccgcag ccttgttcgc ggtgttggca       360
     ggggtgggaa ttgcgctgtc caccggtgga tccaaggggc tacgcccgga gcgtcggatc       420
     aatgctcgtg tgcagctctt cgtccgcgca ctgctgattc tcttcatcgg tttgttgtct       480
     aatctttggc tggatcctcc agtgttcaat atcttgccgt actacgcggt actttttctg       540
     ctggccagtc ttttccttgg agttcgtaaa cgaactctct gcacctgggc attactaatg       600
     atgcttgctg ggccgatcgc acagtacttc gtgcggtcag cggagccgta tgaacgcatt       660
     ctcagccctg tacctgcgga tttaatctcc aatcccgcag atgtgttggg aactttgttg       720
     ttcaccggaa cttatccggt aacgacctgg tccgcctaca tgcttgtggg gttggctctt       780
     ggacggatgc aattgaaccg gattcaggtg caactggggt tgtttggctt cggcgcgttt       840
     gctgcagtat ctggctggct gatgtctcgt atggcggtta atttcctggg cggatatgag       900
     ggcatgctct actctgaggt gcggattact caagaaatgg tggaggcttt cctaacagaa       960
     ggacctgatg aggatctgcc gacttcctca ttctggtggc ttactgtcgc ggggccgcac      1020
     accaacacct ttttctcgct gctgttgagt accggtgtgg cggtgtcggt tctcggcgca      1080
     acttttctga tatgccgagt cttcccgaga ttgttgtggc ctctggctgc agctggttct      1140
     atgaccttga cgctctatgt ctgtcacatg gcttttctgc acttctatgc gatcggtgat      1200
     tattccacag atcaggagct caacttggca ctggcgatcc agattttggg agtgctgatt      1260
     atttctggtc tgtggagctt gcttttccgt cgtggacctc tggaatggct ggtgggtgag      1320
     ctcagtaaga ggattgcgga tccgcggaga aagtcagctg aaactggtgg tgccctgaag      1380
     tctggttcaa ggggtatgac gggaagtggc tggtggcgtc accgggcagt aagtggcaga      1440
     cacagaatgt ag                                                          1452
//

If you have problems or comments...

PBIL Back to PBIL home page