(data stored in ACNUC30630 zone)

EMBL: AP009044.PE336

AP009044.PE336       Location/Qualifiers
FT   CDS_pept        complement(353841..354593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0320"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53284"
FT                   /db_xref="GOA:A4QAN7"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAN7"
FT                   /protein_id="BAF53284.1"
FT                   /translation="MTTLNIGLILPDVLGTYGDDGNALVLRQRARMRGINAEIQRVTLD
FT                   DAVPSTLDLYCLGGGEDTAQILATEHLTKHNGLQTAAAAGRPIFAVCAGLQVLGDSFRA
FT                   AGRVIDGLGLIDATTVSLQKRAIGEVETTPTRAGFTAELTERLTGFENHMGATLLGPDA
FT                   EPLGRVVRGEGNTDVWAASENTDDQRQQFAEGAVQGSIIATYMHGPALARNPQLADLML
FT                   AKAMGVALKDLEPLDIDVIDRLRAERLA"
     atgaccaccc tcaacatcgg cctcatcctc cccgacgtcc tcggaactta cggcgacgac        60
     ggcaacgcgt tagtcctgcg ccaacgcgca cgcatgcgtg gcattaatgc tgaaatccag       120
     cgcgtcaccc tcgacgacgc cgtcccttcc acccttgatc tctactgcct cggcggcggc       180
     gaagacaccg cacagatcct tgccaccgaa cacctcacca aacacaacgg actccaaacc       240
     gcagccgccg caggccgccc catcttcgca gtctgcgcag gtctccaggt actcggcgac       300
     tccttccgcg ccgccggccg cgtcatcgac ggccttgggc ttatcgacgc caccaccgtc       360
     tctttgcaaa aacgcgccat cggtgaagtc gaaacgacac caacccgcgc cggattcacc       420
     gctgagttaa ccgaacgact caccggcttt gaaaaccaca tgggcgccac cctgctcggc       480
     cccgacgccg aaccactcgg ccgagtcgtc cgcggcgaag gcaacaccga tgtctgggca       540
     gcctccgaaa acaccgatga ccaacgccaa caattcgccg aaggcgccgt ccaaggcagc       600
     atcatcgcca cctacatgca cggccccgca ctcgcccgaa acccccaact cgccgacctc       660
     atgctcgcaa aagcaatggg tgtcgcacta aaggatctgg agcctttgga catcgacgtc       720
     atcgaccgcc tccgcgccga acgcctggcg tag                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page