(data stored in ACNUC30630 zone)

EMBL: AP009044.PE341

AP009044.PE341       Location/Qualifiers
FT   CDS_pept        365122..365259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0325"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53289"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAP2"
FT                   /protein_id="BAF53289.1"
FT                   /translation="MLSIPLIFTVENIETTGSSVVDFLGSISIWLYDIFGDTGSATIEA
FT                   "
     atgctgagca ttcccttgat ctttacagtt gagaacatcg aaaccaccgg ctcttcggtt        60
     gtcgatttcc tcggctcaat ttcgatctgg ctttacgaca ttttcggcga taccggaagt       120
     gcaaccatcg aagcataa                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page