(data stored in ACNUC30630 zone)

EMBL: AP009044.PE358

AP009044.PE358       Location/Qualifiers
FT   CDS_pept        378128..378382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0341"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53305"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAQ8"
FT                   /protein_id="BAF53305.1"
FT                   /translation="MSVESIAEVGADMSQGIPKAIDPELLRTVDRVVILGDDAQVDMPE
FT                   SAQGALERWSIEEPDAQGMERMRIVRDQIDNRVQALLAE"
     ttgtctgtgg aatccatcgc tgaggtgggc gctgatatgt cgcaaggaat tcccaaagcg        60
     atcgatccgg agctgctgcg cactgtcgat cgtgtggtca ttttgggcga tgacgcacag       120
     gtagatatgc ctgaatctgc acagggcgct cttgagcgtt ggtcaattga ggaaccggat       180
     gctcaaggta tggaacgtat gcgtattgtg cgggatcaga tcgataaccg agtccaagct       240
     ttgctagcgg aataa                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page