(data stored in ACNUC30630 zone)

EMBL: AP009044.PE359

AP009044.PE359       Location/Qualifiers
FT   CDS_pept        complement(378446..378766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0342"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53306"
FT                   /db_xref="GOA:A4QAQ9"
FT                   /db_xref="InterPro:IPR005133"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAQ9"
FT                   /protein_id="BAF53306.1"
FT                   /translation="MTIPEIIVSILVILAGLFSLGTAIALWRAPDPLTRANLLGPTVGV
FT                   SIPLLIIALLIHTWSVDGFNPNNFIRAIIAIIGVWVIGSVGSYYMGRAIYGVTVVDNRR
FT                   SK"
     atgaccattc cagagatcat cgtctccatc ctcgtgatcc tcgcaggcct attttcccta        60
     ggcaccgcaa tcgctttgtg gcgtgcaccg gatcccctca cccgagccaa cctgcttggc       120
     cccaccgtgg gtgtctccat cccgctgctc atcattgcgc tgctgattca cacctggtcc       180
     gtcgacggat ttaaccccaa caatttcatc cgagcgatca tcgccatcat cggcgtctgg       240
     gtcatcggtt ccgttggttc ctactacatg ggacgcgcca tctatggtgt gaccgtagtg       300
     gataacagac gatccaaata a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page