(data stored in ACNUC30630 zone)

EMBL: AP009044.PE36

AP009044.PE36        Location/Qualifiers
FT   CDS_pept        42155..43027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0036"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52997"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9V4"
FT                   /protein_id="BAF52997.1"
FT                   /translation="MGLPFLWFFSAKEIRKISADADTIIVNSTFALPAVGLAFPMHGRK
FT                   RGGPVISWLVHDTITSLKQRVVAKLGAHSITRAVAVSEVTAASVRPFVGTVLVQPNGVE
FT                   VPSEVVAVKHSQVPTIGILAVITGWKGHDVLLEAVALLPDVHLDIAGEVFAGSEDFEAA
FT                   LRERASQPDLQGRVHFLGHVNKQDVFPQWKALISASTSPEAGPLGVLEAMAYGVPVVAT
FT                   NHGGAAEYLRDGAGILVTPSDPQDLANGIRRILENPEQTAQIIAVARERIIEKHNLVHT
FT                   RERMLEVLS"
     atgggattgc cattcctgtg gtttttctca gctaaggaaa tccgcaaaat ttctgccgat        60
     gcagacacca tcattgtgaa ttccaccttt gccctcccgg ccgtggggct agcttttcca       120
     atgcatggtc gaaagcgtgg tggcccagtt atctcctggc tagtccacga cacgatcacc       180
     agtctgaaac aacgcgtcgt agccaaacta ggtgctcatt caataaccag ggcggtcgct       240
     gtctctgagg tgacggcagc atcagtaaga ccatttgtgg gtacagtgct ggtgcaaccc       300
     aatggtgttg aagtgccgtc ggaagtagtg gctgttaagc acagccaggt accaactatc       360
     ggaatcctgg ctgtgatcac ggggtggaaa ggacacgacg ttcttttaga ggctgtagct       420
     ctgcttccag atgttcactt agacatcgcc ggtgaggtat ttgccggatc ggaagacttc       480
     gaagcagcac tacgagaacg cgcgagtcaa ccagatctac aaggccgcgt gcatttcctc       540
     gggcacgtga acaaacaaga tgtgttccca caatggaaag ccctcatctc agcttcaaca       600
     tccccggaag ctggtccttt aggtgtctta gaggctatgg catacggagt gccagtcgta       660
     gcaacaaatc acggtggcgc agccgaatac ctgcgtgacg gagccggcat acttgtaact       720
     ccatcagatc cacaggactt agcgaacggt atccgccgca tccttgaaaa cccagaacaa       780
     actgcacaaa taattgcagt tgctcgagaa cgaattattg aaaaacataa tctggtgcat       840
     acccgagaac gtatgctgga ggtcttaagc tga                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page