(data stored in ACNUC30630 zone)

EMBL: AP009044.PE363

AP009044.PE363       Location/Qualifiers
FT   CDS_pept        complement(381034..381417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0346"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53310"
FT                   /db_xref="GOA:A4QAR3"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAR3"
FT                   /protein_id="BAF53310.1"
FT                   /translation="MILALTVAILFGGGVYLIQQRGMVRIVFGMSLIGHAANLTILYAG
FT                   VPTWRGEAFPDRTPLTDAADPLPQAFVLTAIVIAMATTTIMLALAALGRSDDTRSIEPD
FT                   DDQSPLTTSARSVTNPTDQEDRA"
     atgattctcg cactgacagt cgcgatactt ttcggtggag gtgtctacct cattcagcaa        60
     cgcggaatgg tgcgcatcgt cttcggcatg tcactgatcg gccacgcagc gaacctgacc       120
     atcctgtacg ccggtgtgcc cacgtggcgc ggcgaagcct tccccgacag gaccccgctt       180
     accgacgccg ccgatcccct cccccaggcc ttcgtgctga ctgccatcgt catcgcgatg       240
     gccaccacaa ccatcatgtt ggccttggca gcactgggac gcagcgacga cacccggtcc       300
     atcgaaccag atgacgatca atcgcctttg actactagcg ctcgttcagt caccaaccca       360
     acagatcagg aggaccgagc ttaa                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page