(data stored in ACNUC30630 zone)

EMBL: AP009044.PE391

AP009044.PE391       Location/Qualifiers
FT   CDS_pept        408287..409231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0373"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53337"
FT                   /db_xref="GOA:A4QAU0"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAU0"
FT                   /protein_id="BAF53337.1"
FT                   /translation="MSNNVVKYECAVDADNIVAVDMHVHLEVDSCGHESMPADIMEASS
FT                   KYFKAAERTPSADAIADIYREHKMAAVVFTIDARTQMGHLPNSIDDLVASCARNNDVLI
FT                   PFGSVDPRTGEDALVEARRQVEELGVRGFKFHPSVQGFDPSAPEFYPLWELLESFGLPC
FT                   VFHTGQNGMGAGLPGGRGIKLRFSNPLLLDDIAADFPNLTIIMAHPSVPWQDEANSIAT
FT                   HKANVFIDLSGWSPKYFPESLVRQSNNVLSKKVLFGTDFPLITPEKWLAAFANLPLKDE
FT                   VRPGILKDNAVKVLGLAASTERGSQAEKAVQHA"
     atgagcaaca acgtagtgaa atatgagtgc gcggtcgacg ccgacaacat tgtcgcagta        60
     gatatgcatg tgcacttgga agtcgacagc tgcggacacg aatcgatgcc ggcagacatc       120
     atggaggcat cctcgaagta ctttaaagct gcggagcgaa ctccctcagc agatgccatt       180
     gctgatattt atagggaaca caagatggcg gcggtggttt tcaccatcga tgcgcggacc       240
     caaatggggc atctgccgaa ctcgattgat gatttggtgg caagctgtgc ccgcaacaat       300
     gacgtgctga tcccttttgg cagtgtggat cctcgtaccg gcgaggacgc gctggtggaa       360
     gctcgccgac aggtggaaga actcggggtg cgaggcttca aattccatcc atcggttcaa       420
     ggattcgacc catccgcgcc agagttctat ccactgtggg aattactgga gagttttgga       480
     ctgccttgtg tgttccacac tggccaaaac ggcatgggtg caggtcttcc aggtggtcgt       540
     ggcattaagc tgcgcttctc caacccactg ttgcttgatg atattgcggc ggatttcccg       600
     aatctgacca tcatcatggc gcacccttct gttccttggc aggatgaggc taactcgatt       660
     gccacccaca aggccaatgt gttcattgat ctttccggct ggtcgccgaa gtatttccca       720
     gagtctttgg tcagacagtc caataacgtg ctgtccaaga aggtgctgtt tggcacggac       780
     ttcccgctga ttaccccaga gaaatggctt gcggctttcg cgaatctgcc actgaaggat       840
     gaggttcgtc cggggatcct caaagacaat gcggtgaagg tacttggcct agccgctagc       900
     actgagcgcg gatctcaagc agaaaaggcc gtgcaacatg cgtga                       945
//

If you have problems or comments...

PBIL Back to PBIL home page