(data stored in ACNUC30630 zone)

EMBL: AP009044.PE409

AP009044.PE409       Location/Qualifiers
FT   CDS_pept        423849..424169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0391"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53355"
FT                   /db_xref="GOA:A4QAV8"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAV8"
FT                   /protein_id="BAF53355.1"
FT                   /translation="MRTKQQREPPELCSDDGSVSIEAALALSSLVIVCGLIIAAMATLA
FT                   AYLAAVDAAGAAARAHAIGESFEPARGHVDMHEAGGMLTATATIPAPIGQVSASAVFPV
FT                   EN"
     atgagaacaa aacagcagcg tgaaccacct gaactgtgca gcgacgacgg ctctgtcagc        60
     atcgaagcag ctctcgcatt gtcatcgctg gtgatcgtgt gcgggttgat cattgcagca       120
     atggccacct tggcggcgta tcttgcagct gttgatgctg ccggcgctgc tgccagggct       180
     catgccattg gggagagctt cgaaccggca cgaggacacg tcgatatgca tgaagcaggg       240
     ggaatgctca ccgcaacagc cactatcccg gcaccgattg ggcaggtgag cgcgagtgcg       300
     gtgttcccgg tggaaaacta g                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page