(data stored in ACNUC30630 zone)

EMBL: AP009044.PE410

AP009044.PE410       Location/Qualifiers
FT   CDS_pept        424144..424491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0392"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0392"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53356"
FT                   /db_xref="GOA:A4QAV9"
FT                   /db_xref="InterPro:IPR021202"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAV9"
FT                   /protein_id="BAF53356.1"
FT                   /translation="MRCSRWKTSCANDEGYMTIASAGVASILISLLVVLAWQAGNLVAR
FT                   EQAQVAADVSAVAGAYAFARGELPDAACATAKHTAEANNAQLENCATEGEDLTLTVTVR
FT                   GQEAHAKAGPL"
     gtgcggtgtt cccggtggaa aactagctgt gcaaatgacg aaggctacat gaccatcgcc        60
     agcgctggtg tcgcctccat cctcattagc ctgctggtgg tgctggcctg gcaggcggga       120
     aacctcgtgg ccagggaaca agcacaggta gcggccgatg tgtcagccgt tgccggagcc       180
     tacgcctttg cccgcgggga actacccgac gctgcctgcg ccaccgcgaa acacacagcc       240
     gaagcaaaca acgcacaact cgaaaactgc gcaacagaag gggaggatct cacgctcacc       300
     gtcaccgttc gtggacaaga agcccacgca aaagcaggac ctttatga                    348
//

If you have problems or comments...

PBIL Back to PBIL home page