(data stored in ACNUC30630 zone)

EMBL: AP009044.PE417

AP009044.PE417       Location/Qualifiers
FT   CDS_pept        complement(434985..435434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0399"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53363"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAW6"
FT                   /protein_id="BAF53363.1"
FT                   /translation="MKKFIAASTILALSLIGAPQAAAFSSGSSGSNIVQPLPEPKPTDL
FT                   NEVLRIIASGYFTHYSNRGYTYDASAENIAQMYFEGTPSQKEYLRQELAAIGAEVIVET
FT                   YPTSTYQDKYTQLVNTPRQPINGTLWGAYIGVNEYTITATLVVTH"
     atgaagaagt tcatcgctgc cagcaccatc ctggcgctct ccctcatcgg agccccacaa        60
     gctgctgcgt tctccagtgg ttccagcgga tcgaatatcg tccaaccgct tccagaacca       120
     aaaccaactg atctaaatga agtcttgaga attattgcta gcgggtattt cacccactac       180
     agcaatcgtg gttataccta cgatgcctcc gctgagaaca tcgcccaaat gtactttgaa       240
     ggaacaccct cgcaaaagga atatctccga caggaactgg ccgcaatcgg cgctgaagtc       300
     atcgtggaga cttatccaac ctccacatat caagacaaat atacccaact agttaacact       360
     ccacggcagc caatcaacgg cacgctttgg ggagcatata ttggggtaaa tgagtacacc       420
     atcacggcaa ccttggttgt tactcactag                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page