(data stored in ACNUC30630 zone)

EMBL: AP009044.PE419

AP009044.PE419       Location/Qualifiers
FT   CDS_pept        436346..437230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0401"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53365"
FT                   /db_xref="GOA:A4QAW8"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAW8"
FT                   /protein_id="BAF53365.1"
FT                   /translation="MAESFIEVSAGHADRRIDKFLRAQLKGVSASLIFRQMRKGDIRVN
FT                   GRKVDPNYRLQEGDRIRMWQMDLPADLPPPVVDKHIFKAVADSVLFEDAELLVINKPAG
FT                   IPVHGGTGHGGGVIEALRQKFPQERDLELVHRLDRDTSGLLLVSKTTSVLRELQEILRD
FT                   REEEIFRGYLLKVEGAWPGDLRQIDVPLKRTETTVVPHSDGLRARTYFEVVKRLPGATL
FT                   VKAQLATGRKHQIRVHAQYAGHPIVGDPRYGSRGGRAATMHLHAAELVVPRGAGKRQKF
FT                   TAPLPKEWGMGRV"
     atggcagaaa gttttataga ggtctcggcg ggacatgcgg atcggcggat agataagttt        60
     ttgcgggcac agctaaaggg cgtgtccgcg tcgttgattt tccgtcaaat gcgtaaaggc       120
     gacattcggg tgaatggtcg taaagtggat ccgaattacc ggttgcaaga aggtgaccga       180
     attcgaatgt ggcagatgga tttgccggca gatttgccgc caccggtcgt cgataagcat       240
     atttttaagg ctgtcgcaga cagcgtgctt tttgaggacg ccgaattact ggtgatcaat       300
     aagccagctg gcattcctgt gcacggtggc acggggcacg gcggtggcgt gattgaggcg       360
     ctgcggcaga agtttccgca ggaacgcgac ctggaattgg tgcatcgttt ggatcgggac       420
     acctcaggtt tgttgctggt ttctaaaacg acatctgtgt tgcgtgagtt gcaggaaatt       480
     ttgcgagacc gcgaagagga gatttttcgg gggtatttgc tcaaggtcga gggggcttgg       540
     cctggcgatt tgcgacaaat tgatgtgccg ttgaagcgga cggagacaac tgttgtgcca       600
     cattcggatg gtttgcgggc gcggacgtat tttgaggttg taaagcgttt gccgggtgcg       660
     accttggtga aggcgcagtt ggcgactggg cggaaacatc agattcgggt ccatgcgcag       720
     tatgcgggtc accctattgt tggcgatcca cgatacgggt cgcgtggggg cagagctgcg       780
     acgatgcatt tgcatgcggc ggaattggtg gtgcctcgtg gggcggggaa gcgtcagaaa       840
     ttcactgcac cgttgccgaa ggagtggggt atgggacggg tctga                       885
//

If you have problems or comments...

PBIL Back to PBIL home page