(data stored in ACNUC30630 zone)

EMBL: AP009044.PE421

AP009044.PE421       Location/Qualifiers
FT   CDS_pept        439737..440843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0403"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53367"
FT                   /db_xref="GOA:A4QAX0"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR017816"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAX0"
FT                   /protein_id="BAF53367.1"
FT                   /translation="MSTVVPGIVALSKGAPVEKVNVVVPDPGANDVIVKIQACGVCHTD
FT                   LAYRDGDISDEFPYLLGHEAAGIVEEVGESVTHVEVGDFVILNWRAVCGECRACKKGEP
FT                   KYCFNTHNASKKMTLEDGTELSPALGIGAFLEKTLVHEGQCTKVNPEEDPAAAGLLGCG
FT                   IMAGLGAAVNTGDIKRGESVAVFGLGGVGMAAIAGAKLAGASKIIAVDIDARKLEWAKE
FT                   FGATHTIDSSGLGGEGDASEVVAKVRELTDGFGTDVSIDAVGIMPTWQQAFYSRDHAGR
FT                   MVMVGVPNLTSRVDIPAIDFYGRGGSVRPAWYGDCLPERDFPTYVDLHLQGRFPLDKFV
FT                   SERIGLDDVEEAFNTMKAGDVLRSVVEI"
     atgagcactg tcgtgcctgg aattgtcgcc ctgtccaagg gtgcaccggt agaaaaagta        60
     aacgttgttg tccctgatcc aggtgctaac gatgtcatcg tcaaaattca ggcctgcggt       120
     gtgtgccaca ccgacttggc ctaccgcgat ggcgatattt cagatgagtt cccttacctc       180
     ctcggccacg aggcagcagg cattgttgag gaggtaggcg agtccgtcac ccacgttgag       240
     gtcggcgatt tcgtcatctt gaactggcgt gcagtgtgcg gcgagtgccg tgcatgtaag       300
     aagggtgagc ccaagtactg ctttaacacc cacaacgcct ctaagaagat gaccctggaa       360
     gacggcaccg agctgtcccc agcactgggt attggcgcgt tcttggaaaa gaccctggtc       420
     cacgaaggcc agtgcaccaa ggttaaccct gaggaagatc cagcagcagc tggccttctg       480
     ggttgtggca tcatggcagg ccttggcgct gcggtgaaca ccggtgatat taagcgtggc       540
     gagtccgtag cagtcttcgg cctgggcggc gtaggcatgg cagctattgc tggtgccaag       600
     cttgcaggtg catcgaagat tattgctgtc gatattgatg ccaggaagct ggagtgggcg       660
     aaggaattcg gcgcgaccca caccattgat tcctctggtc ttggtggcga aggcgatgcc       720
     tctgaggtcg tggcgaaggt tcgtgagctc accgatggtt tcggcaccga tgtctccatc       780
     gacgcggtag gcatcatgcc gacctggcag caggcgtttt actcccgtga ccatgcaggc       840
     cgcatggtga tggtgggcgt tccaaacctg acgtctcgcg tagatattcc tgcgattgat       900
     ttctacggtc gcggtggctc cgtgcgccct gcatggtacg gcgactgcct gcctgagcgt       960
     gatttcccaa cttatgtgga tctgcacctg cagggtcgtt tcccactgga taagtttgtt      1020
     tctgagcgta ttggtcttga tgatgttgaa gaggctttca acaccatgaa ggctggcgac      1080
     gtgctgcgtt ctgtggtgga gatctaa                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page