(data stored in ACNUC30630 zone)

EMBL: AP009044.PE427

AP009044.PE427       Location/Qualifiers
FT   CDS_pept        complement(445282..446118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0409"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0409"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53373"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAX6"
FT                   /protein_id="BAF53373.1"
FT                   /translation="MRDCVPASCSRSMDFMTIKLSSLGSVAPNRKIGHHALGSIPIMDA
FT                   SKNSDFKDTWLVVPCYNEATVIREVLENALKTFPNIVAVNDGSPDNSAEEIHAAGAHLV
FT                   NHPVNLGQGAAIQTGIEYARKQPGAKYFVTFDADGQHQVKDVVRMVERLRAEDVDIIVG
FT                   TRFGRPRQADDQVPLIKRLVLRTVVLLSPKTRRLGLTDAHNGLRVFNQKVAQEMNIRMN
FT                   GMSHASEIVDQIDERGWRISEEPVDILYTEYSMSKGQSLLNGVNILADGFLARRLP"
     gtgcgcgatt gcgtgcccgc cagctgctca agatcaatgg atttcatgac aatcaagtta        60
     tcatcactgg ggtcggtggc acctaacagg aaaatcggcc atcatgcact aggctctatt       120
     cctatcatgg atgcatcaaa aaacagcgac tttaaagaca cctggctagt cgtaccttgt       180
     tataacgagg caacagttat ccgggaagtt ttagagaacg cactcaaaac attccctaat       240
     attgttgcgg tcaacgatgg ctccccggac aactccgcgg aagaaatcca tgcggccggc       300
     gcacacctgg tcaaccaccc cgtgaacctc ggacaaggtg ccgcgatcca aaccggcatc       360
     gaatacgcac gcaagcaacc cggcgcgaaa tactttgtga ctttcgacgc cgacggccaa       420
     caccaagtga aagacgttgt ccgcatggtg gagcgactgc gtgccgagga cgtggacatt       480
     atcgtcggca cgcgttttgg acgcccacgc caagccgatg accaggtgcc actaatcaag       540
     cgccttgtgc tgcgcaccgt ggttctgctg tcaccgaaaa cccgccgact cgggctcacc       600
     gacgcccaca acggcctgcg cgtattcaac caaaaagtgg cgcaggaaat gaacatccgc       660
     atgaacggca tgtcgcatgc atccgaaatc gtcgaccaaa tcgatgaacg cggctggcgc       720
     atttcagaag aacccgtaga catcctctac accgaatact ccatgagcaa aggccaatcc       780
     ctactcaacg gcgtaaacat cctggccgac ggcttcctag cgaggagact cccatga          837
//

If you have problems or comments...

PBIL Back to PBIL home page