(data stored in ACNUC30630 zone)

EMBL: AP009044.PE435

AP009044.PE435       Location/Qualifiers
FT   CDS_pept        complement(455178..456197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0417"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0417"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53381"
FT                   /db_xref="GOA:A4QAY4"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAY4"
FT                   /protein_id="BAF53381.1"
FT                   /translation="MTSLLVTGGAGFIGANFVRQTVEQHPEYTHITVLDKLTYAGNADN
FT                   LKGLPDSKVTLIEGDICDAELVDSLVKDHDITIHFAAESHNDNSLNDPSPFVHTNLIGT
FT                   FVLLEAVRKHNKRFHHISTDEVFGDLELDDPNRFTETTAYKPSSPYSATKAGSDHLVHA
FT                   WIRSFGIQATMSNCSNNYGPYQHIEKFIPRQITNILAGLTPKLYGTGEQVRDWIHVDDH
FT                   NDAVHLILSKGKIGETYIIGADNDHVNNKQVIELICELMGLDKNAYEHVADRPGHDMRY
FT                   AMDSTKLRTELGWAPKYTDVDSGMRKGLEQTIDWYRENEAWWRGTKDNVEATYAKQGQ"
     atgacttctt tgcttgtgac cggaggtgcc ggatttatcg gcgccaactt cgtccgccaa        60
     accgtagagc agcaccctga atacacccac atcacggtgc tggataaact cacctacgca       120
     ggaaacgccg acaacctcaa aggcctcccc gacagcaaag taaccctcat cgaaggcgac       180
     atctgcgatg ctgaattagt cgactccctg gtcaaagacc acgacatcac catccacttc       240
     gcagcagaat cccacaacga caactcactg aacgatccct cccccttcgt ccacaccaac       300
     ctcatcggca cattcgtcct gctagaagcc gtacgcaaac acaacaaacg cttccaccac       360
     atctccaccg atgaagtctt cggcgatcta gagctggatg atccaaaccg cttcactgaa       420
     accaccgcct acaagccatc atccccatat tctgcaacca aggcagggtc tgatcacctg       480
     gtgcatgcat ggatccgttc gttcggaatt caggccacca tgtctaactg ctccaacaat       540
     tacggcccct accagcacat tgagaagttc atcccccgcc agatcaccaa tattctggcc       600
     ggcctgacac caaaactcta tggaaccggc gagcaggtcc gcgactggat ccacgtcgat       660
     gatcacaatg acgccgtcca cctgatcctg agtaagggca agatcggcga aacctacatc       720
     atcggcgccg acaacgatca tgtgaataac aagcaggtca tcgagcttat ttgtgaactc       780
     atgggcctcg acaaaaacgc atacgagcac gtcgcagacc gccccggcca cgatatgcgt       840
     tacgccatgg attccaccaa gctgcgcacc gagctcggct gggcacctaa atacaccgac       900
     gttgattccg gcatgcgaaa aggcctagag cagaccatcg attggtaccg cgaaaacgag       960
     gcctggtggc gcggcaccaa ggacaacgtc gaagcaacct acgcaaagca aggccaataa      1020
//

If you have problems or comments...

PBIL Back to PBIL home page