(data stored in ACNUC30630 zone)

EMBL: AP009044.PE449

AP009044.PE449       Location/Qualifiers
FT   CDS_pept        complement(468140..468706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0431"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53395"
FT                   /db_xref="GOA:A4QAZ8"
FT                   /db_xref="InterPro:IPR008613"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAZ8"
FT                   /protein_id="BAF53395.1"
FT                   /translation="MTARVKMISMRKTIITMLATTAIAFSAISPVQAQTVDTDTDASVS
FT                   SELSSGTSSGSSEDSEDSDLSNRDIIFGVAAIAAVGGLIAGGVHWAVQQRMIPNPLPGI
FT                   IPNPPALAPQAPAPAPAPAPAPQAVAPQAVAPAPAPAPVQTNRTYKNCTEVWNVLGRSI
FT                   RQGEPGYGTHLDRDRDGIGCESRPR"
     ttgacagctc gtgtcaagat gattagcatg cgtaaaacca tcatcaccat gctcgcgacc        60
     accgcgatcg ccttttccgc catctcacca gtgcaggcgc aaaccgtgga cacagacact       120
     gacgcctccg tgtcatctga gctgagcagc ggcacaagct caggaagttc agaggattcc       180
     gaagattctg acctctccaa ccgggacatc atcttcggtg tcgcagctat cgctgcagtc       240
     ggcggactta tcgcaggcgg tgtgcactgg gcagtacaac agcgcatgat cccaaatccc       300
     ctcccaggaa tcattccaaa tcccccagca ttggcacctc aggcgcctgc cccagcaccc       360
     gctcccgctc cggcccctca ggccgtcgcg ccccaggctg ttgcccctgc tcctgcgcca       420
     gccccggtac agaccaaccg cacctacaaa aactgcaccg aagtatggaa cgtcctgggc       480
     cgatcaatcc gccaaggcga accaggctac ggcacacacc tcgaccgcga ccgtgacggc       540
     atcggctgcg aatcacgccc taggtag                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page