(data stored in ACNUC30630 zone)

EMBL: AP009044.PE450

AP009044.PE450       Location/Qualifiers
FT   CDS_pept        complement(469179..470390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0432"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53396"
FT                   /db_xref="GOA:A4QAZ9"
FT                   /db_xref="InterPro:IPR010343"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAZ9"
FT                   /protein_id="BAF53396.1"
FT                   /translation="MCIEGSRFCHLYCLVILGSLFSTGSRIGFCETIPVEERLVAEITT
FT                   PLMEKIRSPAVQSDALQVFKSALAATITWWISVNLLHSQLPFLAPWVALMTMQFTVYHT
FT                   FISGIQTAIASAIGVGLSFVIGTYLDVNVWTFGLAMVIGLIGARVPKLRAEGIGIATTS
FT                   IFLLASGFDDQQPLLYDRILEILLGVAVAIAINLIIFPPLRDREANMVVESLDRRMGEV
FT                   LKKMADELAEKWNIDNADEWLEEIHSINNDLEKAWHSVRFARESRRVNPRKIRIRGGRP
FT                   QPTETSYESNLTRIDEGIAHLRHLARTLRDTPNIDSDWDPVFQKQWVSLMHDAGALLAD
FT                   RNQEIDPIRDRLSKLSSEMSEDQQLTSKKWPIYGSLLTSLFHLSALVDDAVTTRKAEDK
FT                   EHNS"
     ttgtgtatag aaggcagccg gttttgccat ctttattgcc tcgtcatact aggctcactc        60
     ttttctacgg gatctcggat aggcttctgt gaaaccatcc ccgtcgaaga gagactcgtg       120
     gctgaaataa ccaccccatt aatggaaaaa attcgctctc ccgcagtcca atcagatgca       180
     ctgcaggttt ttaaatcagc acttgctgcg acaatcacgt ggtggatttc ggttaacctc       240
     ctccactccc aactaccgtt tttagctccc tgggtagcgt tgatgacgat gcaattcacc       300
     gtctaccaca cctttatcag tggaattcag actgcaattg cttctgccat cggagtcggc       360
     ctttcctttg tcataggcac ctacttagac gtcaatgtgt ggacttttgg cctggcaatg       420
     gtcataggat taataggtgc gcgagtacca aagctccgcg cggaaggaat agggattgct       480
     actacatcca tttttcttct tgcctcgggg tttgatgatc aacaacccct tctatatgac       540
     cgtattctag agatcctgct cggcgtggct gttgccatag ccatcaacct gatcatcttt       600
     cctcccttac gcgaccgaga ggcaaacatg gtggtagaaa gcttagatcg gaggatgggt       660
     gaggttttaa aaaaaatggc cgatgagctt gcagaaaagt ggaatatcga caatgcagac       720
     gagtggctgg aagaaattca ttctattaac aatgacctag aaaaagcgtg gcactccgtg       780
     cggttcgctc gcgaaagccg ccgggttaat cctcgtaaaa ttcgcatccg agggggccgc       840
     ccccagccta cggaaacaag ttatgaatca aacctcaccc gcattgatga agggatcgct       900
     catttacgcc accttgcccg cactcttcgt gataccccga atatagattc cgattgggat       960
     ccagtattcc aaaaacagtg ggtatccctc atgcacgatg ccggagcttt gctcgcagat      1020
     cggaatcaag aaatagatcc tatccgcgac cggctctcta aactctcaag tgagatgagt      1080
     gaggatcaac aattaacttc aaagaagtgg cctatctatg gttctctcct caccagtttg      1140
     tttcaccttt ctgcgcttgt cgatgatgct gtgaccacca gaaaagcgga agataaagag      1200
     cacaatagtt aa                                                          1212
//

If you have problems or comments...

PBIL Back to PBIL home page