(data stored in ACNUC30630 zone)

EMBL: AP009044.PE457

AP009044.PE457       Location/Qualifiers
FT   CDS_pept        478344..479201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_6019"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_6019"
FT                   /db_xref="EnsemblGenomes-Tr:BAQ21081"
FT                   /db_xref="GOA:A0A0B6VR89"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B6VR89"
FT                   /protein_id="BAQ21081.1"
FT                   /translation="MLNKPTVMVRNLSKTYSVGKNGSERSIFQRSNRIRVEALKDVSFV
FT                   TYTGESIGILGRNGSGKTTLLNLIAGNETASNGEILVSAQPTYLGVSAALQNHLSGAAN
FT                   VRLGLLAMQLSREEVLAKEEQVLEWAELQEASDRPLRTYSSGMRARLQFAISTAVKREI
FT                   LLVDEALSTGDSTFSAKARNRMNEFLEESGTVFIVSHAPGTIERYCKRSIWLHKGEIIA
FT                   DGRTRMVTKYYRQWAEREAKGNFRGAEIVIENMKLRYEPKNLILASEEKTVFGNTELKS
FT                   SHSQ"
     ttgttaaata agcccactgt aatggtgcgc aatctgagta aaacctattc cgttggaaaa        60
     aatggatcag aacgtagcat cttccaacgg agcaatcgta ttagagttga agctcttaaa       120
     gatgtaagtt ttgtgaccta tacgggtgaa agcatcggta tccttggccg aaatggctct       180
     gggaagacga cgcttcttaa cctaattgca ggcaatgaaa ctgcctccaa tggtgaaata       240
     cttgtatcgg ctcaaccaac ttaccttgga gtgtcagcgg ctctacagaa tcatctttcg       300
     ggggctgcta atgttcgcct cggtcttttg gcaatgcagc tttctagaga agaagttctt       360
     gcaaaagaag agcaagtctt agagtgggca gaattgcagg aagccagcga cagacccctt       420
     cgtacgtact cttcgggaat gcgagcccgc ttgcaatttg caatttctac tgcggtaaaa       480
     cgtgagattc tcttagttga tgaagcttta tctactggag actctacttt cagcgcaaaa       540
     gctaggaatc gtatgaatga gtttcttgag gaatccggca cggtcttcat tgtttcccat       600
     gcgccgggaa ctattgaacg gtactgcaag aggtcgattt ggttgcataa aggcgaaatt       660
     attgcagatg gtaggactcg gatggttacg aaatactaca ggcaatgggc agagcgagaa       720
     gcgaaaggaa attttcgtgg tgcagagata gtcattgaaa atatgaaact ccgctatgaa       780
     ccaaagaact taattctcgc cagtgaggag aaaacagttt ttggtaatac tgaattaaaa       840
     tcaagccact cacagtag                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page