(data stored in ACNUC30630 zone)

EMBL: AP009044.PE471

AP009044.PE471       Location/Qualifiers
FT   CDS_pept        500065..500946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0447"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53411"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR012640"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB14"
FT                   /protein_id="BAF53411.1"
FT                   /translation="MKKYAVAALALLTLAGCSTSEEVAVSSDSAPQRIVIAQANFLDLA
FT                   LALDLEPVGTTYWGGAGGVQDYLLDSVPASMEVVGNDDEPNFETVAKLQPDLIIGDEEI
FT                   ETNLAKYEAIAPVSIIKSVDDNGSNSWRDQLTALAELTGTQEKAAAVIEEADKSVASLD
FT                   SKITSPGEKTMLLRIREEQVRQYFPDSFVGAGVPQRLQNITLVESAVPSENGQWSVIPP
FT                   ENIGLLDADRIIAFIDSPQALENAESNPLWRQLPAVKNGQLCTTENLTPWILTGPAAAE
FT                   IVTSDLEACFAA"
     atgaaaaagt atgcagtcgc ggccctcgcg ctactcaccc tggcgggatg ttctactagt        60
     gaagaggtgg cggtttcttc tgactcggct ccgcagagga ttgtgattgc ccaagccaac       120
     ttcctcgatc tcgccctcgc actcgacctc gaaccagtcg gaaccaccta ctggggcgga       180
     gccggaggag tgcaggatta tttgctagat tccgtccctg catcgatgga agtagttgga       240
     aacgacgacg aacccaactt cgaaaccgtc gccaaactcc aacccgacct catcatcggc       300
     gacgaagaaa tcgaaaccaa cctcgccaaa tacgaagcca tcgcacccgt ctccatcatc       360
     aaatccgtcg acgataacgg atccaacagc tggcgcgacc aactcaccgc cctcgctgaa       420
     ctcaccggca cccaagaaaa agcagccgca gtgattgaag aagcggacaa atccgtagct       480
     tcactggact cgaagattac gtcgcccggt gagaagacca tgctgctccg catccgcgaa       540
     gaacaagtcc gccaatactt ccccgacagc ttcgtcggcg ccggcgtccc ccaacgcctc       600
     caaaacatca ccctcgtcga atccgccgtc ccctccgaaa acggccaatg gtcagtcatt       660
     ccacccgaaa acatcggact tctcgacgcc gaccgcatca tcgccttcat cgacagcccc       720
     caagccctcg aaaacgccga aagcaaccca ctgtggagac aactccccgc agtcaaaaac       780
     ggtcaactct gtaccacgga aaacctcacc ccatggatcc tcaccggacc agcagcagcc       840
     gagatcgtga cctctgacct cgaggcatgt ttcgctgctt ag                          882
//

If you have problems or comments...

PBIL Back to PBIL home page