(data stored in ACNUC30630 zone)

EMBL: AP009044.PE473

AP009044.PE473       Location/Qualifiers
FT   CDS_pept        complement(502499..503476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0449"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53413"
FT                   /db_xref="InterPro:IPR009351"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB16"
FT                   /protein_id="BAF53413.1"
FT                   /translation="MPALSLGRVRALRLISQLLAPSAALKMKPERNAVDVAKHMLASQA
FT                   QQRGSALVALDARAENADAATAVEQSLLIRSWTQRGTHQILAAEDVRWMTLLCSPRILA
FT                   ASAKRRPSLSLDSAAVQRARDALATAAEKSPVSRTQAYEIFRSADVDPGENRGQHLLRH
FT                   FGGEGDIVQGPPINGEDSFVLLDSICPLSLALTGDEALTEMTRRYFYSRGPATQKDLVW
FT                   WTGLTVRDVKKGIAAVSAEGSIAAVQGPNGEEMWIPTWAQDVTETEVNDALALELTLPA
FT                   FDEYLLSYTDRSHVMDPEHLFSIGPGKNGVFKPFKVIHGEALPV"
     atgcctgcac tttctctagg acgcgtccgc gcgctgcgcc tcatttctca actcctcgca        60
     ccatctgcgg cgctcaaaat gaagcctgag cgcaatgccg tcgacgtggc aaaacacatg       120
     ctggccagcc aggcacaaca acgtggatcc gcgctggtcg ccctggatgc acgagcagaa       180
     aacgccgacg ccgccaccgc agtcgaacaa tcgctactca tccgcagctg gacacaacgc       240
     ggcacccacc aaatccttgc cgccgaagac gtccgctgga tgacgctgct atgttcccca       300
     cgcatcctcg ccgcttcagc caagcgccgc cccagccttt cgcttgatag cgccgccgtc       360
     cagcgcgccc gtgacgccct tgccacggcc gccgaaaaat cccccgtttc cagaacccaa       420
     gcctacgaaa ttttccgatc cgcagacgta gaccccggag aaaaccgcgg ccagcatctc       480
     ctgcgacact tcggcggcga gggcgacatc gtccaaggcc cacccatcaa cggtgaggat       540
     tccttcgtgc ttctcgattc catctgcccc ctttccctcg ctctgaccgg cgacgaagcc       600
     ctcacggaaa tgacccgccg gtacttctac tcccgtggcc ccgccaccca gaaagacctc       660
     gtgtggtgga caggactcac ggtccgcgac gtcaagaaag gcatcgccgc agtctccgcc       720
     gaaggttcaa tcgccgcagt tcagggacct aacggcgaag aaatgtggat ccccacttgg       780
     gcgcaagacg tcaccgaaac agaagtcaac gacgccctcg cactggagct aaccctcccc       840
     gccttcgacg aatacctact ttcctacacc gaccgcagcc acgtcatgga tcccgagcac       900
     ctgttcagca tcggccccgg caagaacggt gtgttcaaac cattcaaagt catccacggc       960
     gaggcgctgc cggtttag                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page