(data stored in ACNUC30630 zone)

EMBL: AP009044.PE476

AP009044.PE476       Location/Qualifiers
FT   CDS_pept        505309..505614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0452"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0452"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53416"
FT                   /db_xref="GOA:A4QB19"
FT                   /db_xref="InterPro:IPR019662"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB19"
FT                   /protein_id="BAF53416.1"
FT                   /translation="MDISMLNVITSYTVWAIFAIIGICGFVGAFLAATTREDAFEVADR
FT                   QKKIVWVAILIASGFVLTVLGPSIPILPWVAIIMIGLYWFDVRPQIKSILEGAGGW"
     atggatattt ccatgctcaa cgtaataacg agctacaccg tttgggccat ttttgccatc        60
     atcggcatct gcggattcgt tggtgccttc ttggcagcca ccaccagaga agatgccttt       120
     gaggttgctg atcgccaaaa gaaaatcgtg tgggtagcaa ttttgatcgc atctgggttt       180
     gtcctcacgg tgttaggccc atcgattccg atcctgccct gggttgccat catcatgatc       240
     ggcctctact ggttcgatgt gcgcccacaa atcaagagca tccttgaagg tgccggcggc       300
     tggtaa                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page