(data stored in ACNUC30630 zone)

EMBL: AP009044.PE487

AP009044.PE487       Location/Qualifiers
FT   CDS_pept        517644..518723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0462"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53426"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB29"
FT                   /protein_id="BAF53426.1"
FT                   /translation="MNNAFRRTLTSVVLAASLALTACASWDSPTASSNGDLIEEIQASS
FT                   TSTDPRTFTGLSIVEDIGDVVPVTDNASPALPVSLTDADGNDVVVEDVSRILPLDLYGT
FT                   YSKTIAGLGLVDNIVGRTVSSTEPALADTEVVTTGGHTLNAEAILNLHPTLVIIDHSIG
FT                   PREVIDQIRAAGVATVIMSPQRSISSIGDDIRDIASVVGLPEEGEKLAERSVAEVEEAS
FT                   TVVDELTPEDPLKMVFLYARGTGGVFFILGDAYGGRDLIEGLGGVDMAAEKGIIDLAPA
FT                   NAEALAELNPDVFVMMSGGLVSTGGIDGLMERPGIAQTTAGQNQRVLALPDGQSLAFGA
FT                   QTGELLLRASRELYVQGGE"
     atgaataacg cttttcgacg cacccttaca tccgtagtcc tcgccgctag cttggcctta        60
     acggcctgcg caagctggga ttcacctacg gcatcttcca atggtgatct gattgaggag       120
     atccaggcaa gctccacctc aacagatccg cgcaccttca caggcttgag catcgtggaa       180
     gatatcggcg atgtggttcc cgtaaccgac aacgcctcac cagctctgcc agtttctttg       240
     accgacgctg atggcaacga cgtggtggtg gaggacgtgt cccgcatcct cccactggat       300
     ctgtatggaa cctattccaa aaccatcgct ggcctgggac tcgtagacaa tattgtgggt       360
     cgtactgtta gttccaccga gcctgcattg gcggacactg aggtggtcac cactggcgga       420
     cacaccctca atgctgaagc gatccttaat ttacatccga ctttggtgat catcgaccac       480
     tcgatcggcc cacgcgaagt catcgatcag atccgcgcag ctggtgtcgc cacggtgatc       540
     atgtcgccgc agcgttccat ttcctcaatt ggcgacgaca tccgtgacat cgcctccgtc       600
     gttggacttc ctgaagaagg ggagaagctc gcggaacgtt ccgttgctga agtcgaagag       660
     gccagcacgg ttgtcgatga actcacccca gaagatcccc tcaaaatggt attcctctat       720
     gcccgcggaa ctggtggagt gttcttcatt ttgggcgatg cctatggtgg acgcgatctc       780
     attgaaggcc tgggcggcgt cgacatggct gctgaaaagg gcatcattga tctggcacca       840
     gccaacgcgg aagcacttgc cgaactaaat ccagacgtct tcgtgatgat gtcgggagga       900
     ctagtctcga caggaggcat cgacggtctt atggaacgcc ccggcattgc gcagacaacc       960
     gccggacaaa atcaacgagt actggcgctt cccgatggtc aatcattggc ctttggtgcc      1020
     caaactggcg agttgttgct ccgcgcatcc cgcgaactgt atgtgcaggg cggcgagtag      1080
//

If you have problems or comments...

PBIL Back to PBIL home page