(data stored in ACNUC30630 zone)

EMBL: AP009044.PE49

AP009044.PE49        Location/Qualifiers
FT   CDS_pept        55426..56115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0049"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0049"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53010"
FT                   /db_xref="GOA:A4Q9W7"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9W7"
FT                   /protein_id="BAF53010.1"
FT                   /translation="MKDELKIVGFMNVERIYRQAPASTLISLAIIAVYAVTAIQSRSVT
FT                   DNLGSTSIGDAWILYAPLMDDGGFGPLRAIGGIFLHIGPGHMLLNLVLLWLLGREIERD
FT                   FGSALFTAMYFVGGIGASAAVIWMDPYSPTAGASGAIYAMMAILVGLFVLRSADIRAPL
FT                   ILIAINIAYTLMSTNVSLWGHLGGLITGALITWPMVKAKNKRTRWIIVLIGLAVVVVAV
FT                   ILGIDRV"
     ttgaaagacg agttgaagat tgttggattc atgaatgtag aacggattta tcgacaagcg        60
     ccagcaagta cgttgatctc tttagccatc atcgctgtgt acgcagtgac ggccattcaa       120
     tcgagatcag tgacagacaa cctgggttca accagtatcg gtgacgcgtg gattctgtac       180
     gcaccgctga tggatgatgg tggctttggt ccactgcgtg ccatcggagg aattttcctg       240
     cacattggcc ccgggcacat gctgttgaac cttgtgttgt tgtggttgct gggaagagaa       300
     attgaacgag acttcggttc tgcgcttttc actgcgatgt actttgtggg cggtattggt       360
     gcgtctgcag ctgtcatctg gatggatccc tattcaccga cagcaggtgc ttccggcgct       420
     atttacgcca tgatggctat tttggtgggg ctttttgtgt taagaagcgc ggatatccga       480
     gcacccttga tccttatcgc catcaacatc gcctatacct tgatgtccac caatgtttct       540
     ctgtggggac accttggagg tttgatcact ggagctttaa ttacttggcc aatggttaaa       600
     gcgaaaaata aaagaacacg gtggattatc gtgctcattg gtcttgctgt agttgtggtt       660
     gctgtcatcc taggaatcga ccgggtgtag                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page