(data stored in ACNUC30630 zone)

EMBL: AP009044.PE494

AP009044.PE494       Location/Qualifiers
FT   CDS_pept        complement(524347..524850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0469"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53433"
FT                   /db_xref="InterPro:IPR019639"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB36"
FT                   /protein_id="BAF53433.1"
FT                   /translation="MATRTENTITINQPVGKVHQALTTEAYWAYIAENLSPEAGEVNEF
FT                   TAADGGATATLFEVLPLEVLPEAVRAMISQALKVKRVLTVPALTNNATTVEYNADVKGT
FT                   PVDFKGTIAINGDDAATTFDYSNEVSVNIPFMGPAIEPKVADALGELFANEGALTEKWI
FT                   SENL"
     atggcaacgc gtacagaaaa caccattacg atcaatcagc ccgtcggcaa ggtgcaccaa        60
     gcactgacca ccgaagccta ctgggcatac atcgcagaga acctctcccc cgaagctggc       120
     gaggtcaacg agttcaccgc agctgacggt ggcgcaaccg caaccctttt tgaggtcctc       180
     ccactcgagg tcctcccaga ggcagttcgc gcaatgatca gccaggcact gaaggtcaag       240
     cgagtcctca ccgttcctgc actgaccaac aacgccacaa ccgtcgagta caacgctgac       300
     gtcaagggca cccctgttga tttcaagggc accatcgcca tcaacggcga cgacgcagca       360
     accaccttcg actacagcaa cgaagtgtcc gtgaacatcc cattcatggg tcctgcaatc       420
     gagcctaagg ttgccgacgc actcggcgag ctcttcgcaa acgaaggcgc tctgaccgaa       480
     aagtggatct ccgagaacct ctaa                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page