(data stored in ACNUC30630 zone)

EMBL: AP009044.PE495

AP009044.PE495       Location/Qualifiers
FT   CDS_pept        524875..525981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0470"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53434"
FT                   /db_xref="GOA:A4QB37"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QB37"
FT                   /protein_id="BAF53434.1"
FT                   /translation="MLDSSLAQEIAAIDGVELDSKVTFADLTTLRIGGKPRSAVRCQTT
FT                   EALVSAIKLLDDASLPLLIVGGGSNLVVADGDLDVIAVIIETDDVSINLTDGLLTADAG
FT                   AVWDDVVHLSVDAGLGGIECLSGIPGSAGATPVQNVGAYGTEVSDVLTRVQLLDRTTHQ
FT                   VSWVDASELDLSYRYSNLKFTNRAVVLAIELQLLTDGLSAPLRFGELGRRLAISEAEPH
FT                   PRRPVRMVRDAVLELRRAKGMVVEHTDHDTWSAGSFFTNPIVDPALADAVFEKVGEPTM
FT                   PRFPAGDGKEKLSAAWLIERAGFKKGHPGAGAKASLSTKHTLALTNRGDARASDLVALA
FT                   KEIRDGVLETFGVTLVPEPVWIGISIDD"
     gtgttggatt catcgctagc ccaggaaatc gccgcgatcg acggcgtcga actcgattcg        60
     aaagtcactt tcgccgatct gacgaccctc cgcatcggcg gaaaaccccg cagtgccgta       120
     cgttgccaga ccacagaggc gctggtcagc gccataaaat tgcttgacga cgcctccctc       180
     cccctcctca tcgtcggcgg cgggtccaat ctcgtcgtgg ccgacggcga tctggatgtt       240
     attgccgtca tcatcgaaac cgacgacgtc tccatcaacc tcaccgacgg tctcctcacc       300
     gccgatgcag gcgccgtttg ggacgatgtt gtccaccttt cggtggatgc cggcctcggt       360
     ggaattgaat gcctctccgg aatccccggc tccgccggcg ccaccccagt ccaaaacgtg       420
     ggcgcctacg gcacggaagt ttccgatgta ctcacccgcg tccagcttct cgaccgcacc       480
     acccaccaag tctcctgggt cgacgcctcc gaactcgacc tttcttaccg atactccaat       540
     ctcaaattca ccaaccgcgc agtcgtcttg gcgatcgaac tccagctcct caccgacgga       600
     ttgtccgcgc cgctacgttt tggtgaattg ggacgtcgat tagcgatctc cgaggccgaa       660
     ccccacccac gtcgccccgt ccgcatggtc cgcgacgccg tcttagaact ccgtcgcgcc       720
     aaaggcatgg tcgtggaaca caccgaccac gacacctggt ccgccggatc cttcttcacc       780
     aatccaatcg tcgacccagc ccttgccgac gcagtctttg aaaaagtcgg cgaacccacc       840
     atgccccgct tcccagccgg cgatggcaaa gaaaaactct ccgcagcctg gctcatcgaa       900
     cgcgccggct tcaaaaaggg acaccccggc gcaggcgcaa aagcctccct gagcaccaaa       960
     cacaccctcg cactcaccaa ccgtggcgac gcccgcgcct ccgacctcgt cgcattagcc      1020
     aaagaaatcc gcgacggagt cctcgaaacc ttcggcgtca ccctcgtccc agaacccgtc      1080
     tggattggaa ttagcatcga tgactaa                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page