(data stored in ACNUC30630 zone)

EMBL: AP009044.PE498

AP009044.PE498       Location/Qualifiers
FT   CDS_pept        528971..530227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0473"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53437"
FT                   /db_xref="GOA:A4QB40"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR017814"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QB40"
FT                   /protein_id="BAF53437.1"
FT                   /translation="MRVAMISMHTSPLQQPGTGDSGGMNVYILSTATELAKQGIEVDIY
FT                   TRATRPSQGEIVRVAENLRVINIAAGPYEGLSKEELPTQLAAFTGGMLSFTRREKVTYD
FT                   LIHSHYWLSGQVGWLLRDLWRIPLIHTAHTLAAVKNSYRDDSDTPESEARRICEQQLVD
FT                   NADVLAVNTQEEMQDLMHHYDADPDRISVVSPGADVELYSPGNDRATERSRRELGIPLH
FT                   TKVVAFVGRLQPFKGPQVLIKAVAALFDRDPDRNLRVIICGGPSGPNATPDTYRHMAEE
FT                   LGVEKRIRFLDPRPPSELVAVYRAADIVAVPSFNESFGLVAMEAQASGTPVIAARVGGL
FT                   PIAVAEGETGLLVDGHSPHAWADALATLLDDDETRIRMGEDAVEHARTFSWAATAAQLS
FT                   SLYNDAIANENVDGETHHG"
     atgcgcgtag ctatgatttc catgcacacc tctccattgc agcagcccgg aactggtgat        60
     tcaggcggca tgaacgtcta cattctttcg accgcgactg agctagcgaa acagggtatc       120
     gaggtcgata tttacactcg tgccacgagg ccttctcagg gcgagatcgt gagagttgct       180
     gagaatttgc gggtcattaa tatcgctgcg gggccgtatg aggggctttc caaagaggaa       240
     cttcctaccc aattggcggc gtttaccggc ggaatgttgt cgtttacgcg ccgggagaag       300
     gttacttatg atctgatcca ttctcactat tggctttctg ggcaggtggg gtggttgctg       360
     cgcgatttgt ggcggattcc ccttattcat acggcacaca ctttggcggc ggtgaagaat       420
     tcttatcggg atgattcgga taccccggag tcggaggcgc gtcgcatttg tgagcagcag       480
     ctggtggata acgctgacgt gttggcggtg aacactcagg aggagatgca ggatttgatg       540
     catcactacg atgcggatcc ggatcggatt tctgtggtgt cgccgggtgc agatgtggaa       600
     ctttatagcc ctggaaatga tcgcgcgacg gaacgttccc gtcgtgagct gggcattccg       660
     ctgcacacaa aggtggtggc ttttgtgggt cggttgcagc cgtttaaggg cccgcaggtg       720
     ctgatcaagg cggttgcggc gttgtttgat cgcgatccgg accgaaatct gcgcgtcatt       780
     atttgtggcg gcccttctgg tccgaatgcg acaccggata cctataggca tatggcagag       840
     gaactgggcg tcgaaaagcg aattcgcttt ttggacccgc gcccgccgag cgagctagtg       900
     gccgtgtatc gggcggcgga catcgtggcc gtgcccagtt ttaatgagtc cttcggactc       960
     gtcgccatgg aggcgcaagc cagcggcaca ccggtcattg cggcccgggt tggcggcctg      1020
     cccatcgcag tcgcggaagg ggagacggga ttgcttgtcg acggccactc cccgcatgcc      1080
     tgggccgacg ccttagccac actcttggac gatgacgaaa cgcgcatcag gatgggcgaa      1140
     gatgccgtcg aacacgccag aacattctcc tgggcagcca ccgccgcgca gctatcgtcg      1200
     ctgtacaacg acgctattgc caacgaaaac gtcgacggtg aaacgcatca cggctaa         1257
//

If you have problems or comments...

PBIL Back to PBIL home page