(data stored in ACNUC30630 zone)

EMBL: AP009044.PE501

AP009044.PE501       Location/Qualifiers
FT   CDS_pept        532265..532963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0476"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53440"
FT                   /db_xref="GOA:A4QB43"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB43"
FT                   /protein_id="BAF53440.1"
FT                   /translation="MTTILIVEDEESLADPLAFLLRKEGFDTIIAGDGPTALVEFSRNE
FT                   IDIVLLDLMLPGMSGTDVCKELRSVSTVPVIMVTARDSEIDKVVGLELGADDYVTKPYS
FT                   SRELIARIRAVLRRRGVTETEAEELPLDDQILEGGRVRMDVDSHTVTVDGEPVSMPLKE
FT                   FDLLEYLLRNAGRVLTRGQLIDRIWGADYVGDTKTLDVHVKRLRSKIEEEPSRPRYLVT
FT                   VRGLGYKFEL"
     atgacgacaa tcctgatcgt tgaagatgag gaatcgttag cagatccttt ggcctttctt        60
     cttcgcaaag aaggttttga caccatcatc gccggtgatg gcccaaccgc tcttgtggag       120
     ttcagtcgca acgaaatcga tatcgtcctc ttagacctca tgctcccagg catgtctggc       180
     accgacgtat gcaaagaact ccgcagcgta tccactgttc ccgtcatcat ggtcaccgcc       240
     cgcgactccg agatcgacaa agttgttggt ctcgaactcg gcgccgatga ttatgtaacc       300
     aagccatatt cttcccgcga actcatcgcc cgcatccgcg ctgtcctgcg ccgacgcgga       360
     gttactgaaa ccgaagccga agaattacca cttgacgatc aaatcctcga aggcggccgc       420
     gtccgcatgg acgtcgattc ccacaccgtc accgtcgacg gcgaaccagt gagcatgcca       480
     ctgaaggaat tcgaccttct ggagtacctc ctccgcaacg ccggccgagt cctcacccgc       540
     ggacagctca tcgaccgaat ttggggcgca gattacgtcg gcgacaccaa aaccctcgac       600
     gttcatgtca aaaggttgcg ttccaagatc gaagaagagc catctcgacc tcgttacctc       660
     gtgaccgtgc gtggattggg ctacaaattc gagctgtag                              699
//

If you have problems or comments...

PBIL Back to PBIL home page