(data stored in ACNUC30630 zone)

EMBL: AP009044.PE512

AP009044.PE512       Location/Qualifiers
FT   CDS_pept        complement(541663..541905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_5004"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_5004"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53451"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB54"
FT                   /protein_id="BAF53451.1"
FT                   /translation="MVSFAHFVRGGEPADSDQKLVQSSAPWFNTDVFQNPSTRIAFPGS
FT                   LRPPNPQRTHKNPQRTPPKTQKSTAPEGGASLKLN"
     ttggtctcat ttgcacattt cgttcgaggc ggcgaacctg cagattcaga ccaaaagctc        60
     gtccagagca gtgctccttg gttcaatacg gacgttttcc aaaaccccag cacccgaatc       120
     gctttcccgg ggagtttgag acccccgaac ccacaaagaa cccataaaaa tccccaacgc       180
     accccaccca agactcaaaa aagcaccgcc ccggaaggcg gtgctagttt gaagctcaat       240
     tga                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page