(data stored in ACNUC30630 zone)

EMBL: AP009044.PE516

AP009044.PE516       Location/Qualifiers
FT   CDS_pept        543207..543524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0487"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53454"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB57"
FT                   /protein_id="BAF53454.1"
FT                   /translation="MSIVSMVKLSGRIRSRRVAKCEGVGATMGHSVEIIVRDNCGSCVR
FT                   VKAQILPIVGAAGIKLTERNVDQDASLKLEFGDRVPVILVDDEEFACWEVDNDELANAL
FT                   L"
     ttgagtatcg tatccatggt aaagctttcg gggcggatac gctcgcgaag ggtagcgaaa        60
     tgtgagggag tgggcgcaac catgggccat tcggtggaga tcattgttcg ggacaattgt       120
     ggctcgtgtg ttcgggtgaa agcccagatt ttgccgattg ttggggctgc cggaattaaa       180
     ctcactgagc gaaatgttga tcaagatgcg agccttaaac tggaattcgg tgatcgcgtg       240
     ccagtcattt tggtagatga tgaagagttc gcatgttggg aagtggataa cgacgagtta       300
     gccaatgctt tgttgtga                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page