(data stored in ACNUC30630 zone)

EMBL: AP009044.PE518

AP009044.PE518       Location/Qualifiers
FT   CDS_pept        545006..545914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0489"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0489"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53456"
FT                   /db_xref="GOA:A4QB59"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QB59"
FT                   /protein_id="BAF53456.1"
FT                   /translation="MTLKIGTRGSKLATTQAGTIRDQLKYFGRDAELHIVTTPGDVNMS
FT                   PVERIGVGVFTQALRDVLHAGECDVAVHSMKDLPTAADPRFHLVVPTRADSREALIARD
FT                   GLTLAELPEGAKVGTSAPRRISQLKAIRPDLEILPLRGNIDTRMGKVTSGELDAVMLAY
FT                   AGLTRVGMQDRATEVFDADIIMPAPAQGALAIECRADDTETVRALNMLMHADTFVSAVA
FT                   ERTVLNRLEAGCTAPVAAHATLDGYSGDTMTLTAGVYALDGSDQLVFSAEGDGARPEEL
FT                   GELVAQQLIDAGAANLLGDRS"
     atgaccttaa aaattggtac ccgaggatcc aaacttgcca ccacccaagc tggcaccatc        60
     cgcgaccagc tgaaatactt cggacgcgac gccgaactgc acattgtgac cacccccggt       120
     gatgtcaata tgtccccagt tgagcgcatt ggcgtcggcg tgttcaccca ggcgctgcgt       180
     gatgtgctgc atgctggtga atgcgatgtg gctgtgcact ccatgaagga tctgccgacc       240
     gccgccgatc ctcgattcca cctggtcgtg ccaactcgtg cggactcccg cgaggccctt       300
     atcgcccgcg acggcctgac tctggctgag cttccagaag gcgcaaaggt gggaacttcc       360
     gctcctcgac gtatctctca actcaaggca atccgtcctg acctggagat tctcccactg       420
     cgcggaaata tcgacacccg catgggtaaa gttacctccg gtgaactcga tgccgtgatg       480
     ctcgcctacg cgggtcttac tcgcgtcggc atgcaggacc gcgcaacgga agttttcgac       540
     gccgacatca tcatgcccgc ccccgcacag ggcgcacttg cgatcgaatg ccgcgccgac       600
     gacaccgaaa ccgtccgcgc gctcaacatg ctgatgcatg ccgacacgtt tgtctccgcg       660
     gttgcagaac gcaccgtgct caaccgcctc gaagctggct gcaccgcgcc tgtcgcagcg       720
     cacgccacct tggacggcta ctccggcgac accatgactc ttaccgccgg cgtttacgca       780
     cttgacggct ctgaccagct ggtattctcc gccgaaggtg acggcgcccg cccagaagag       840
     ctcggcgagc tcgttgcaca acagcttatc gacgccggag ccgccaattt gctcggcgac       900
     cgcagctaa                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page