(data stored in ACNUC30630 zone)

EMBL: AP009044.PE519

AP009044.PE519       Location/Qualifiers
FT   CDS_pept        546317..546691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0490"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53457"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB60"
FT                   /protein_id="BAF53457.1"
FT                   /translation="MIVVAELRINNRIVTVHLSWWEKLSARRSHLRIPRKAIRNIQVVD
FT                   NVISSVDRPIKRTGRLRIPGVFVAGTHAYVNETLSENEFSMCRKNEPGLVIELENISID
FT                   RIVISTPDAHRYADELMAAV"
     ttgatcgttg tggctgagtt gagaatcaat aatcgtatcg tgactgttca tttgtcatgg        60
     tgggagaagt tgagtgctag gcgtagccat ttgaggattc ctcggaaagc aatccggaac       120
     attcaggttg tagacaatgt catcagttca gttgaccgtc ccattaagcg cactggtcgt       180
     ttgcgtattc cgggggtctt tgtggctggc actcatgcgt atgtcaatga gactctttcg       240
     gaaaatgagt tcagtatgtg ccggaagaac gagccaggtt tggtcattga gctggagaat       300
     atcagcatcg atcgcattgt catttccaca ccagatgccc accgctatgc ggatgagctc       360
     atggcggctg tttag                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page