(data stored in ACNUC30630 zone)

EMBL: AP009044.PE538

AP009044.PE538       Location/Qualifiers
FT   CDS_pept        569156..569764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0508"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0508"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53476"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB79"
FT                   /protein_id="BAF53476.1"
FT                   /translation="MTQTIVHLVRHGEVHNPEKILYGRMPGYRLSSRGRSQAARTAASF
FT                   EGHDVTYIAASPLQRVQETSEPFIKVTGLELITDEDLLEAGNRFEGLRTKGWRSQLWNP
FT                   VRWPLMYNPTLPSWGEHYTDILERMMAAVERARVAAEGHEAILVTHQLPIVCVQRHARG
FT                   QSLSHNPATRQCDLASVTSLVFQDDQIVGVHYNEPAQEI"
     atgacgcaaa ccattgtcca tctagttcgc cacggcgaag tccacaaccc agagaaaatc        60
     ctgtacggac gcatgcccgg atacaggttg tcttcccgtg gacgcagcca agccgcccgc       120
     actgcagcct cttttgaagg ccacgatgtc acctacattg cggcctcccc attgcagcgt       180
     gtgcaggaaa cctccgaacc gttcatcaag gtcacaggcc tagaactgat caccgacgag       240
     gatcttctgg aggcaggcaa ccgtttcgaa ggcctgcgca ccaaaggttg gcgttcccag       300
     ttgtggaacc ccgtgcgttg gcctttgatg tacaacccca cgcttcccag ctggggcgaa       360
     cactacaccg acattttgga aagaatgatg gcggctgtgg aacgagctcg ggtggcagcg       420
     gaaggacacg aagcaatcct ggtgacccac cagttgccga tcgtgtgcgt gcaacgccac       480
     gcccgcggac aaagcctgtc acacaaccca gcgaccaggc aatgcgacct cgcctcagtg       540
     acatccttgg tgttccaaga cgatcaaatt gtcggcgtgc attacaacga accagctcag       600
     gagatttga                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page