(data stored in ACNUC30630 zone)

EMBL: AP009044.PE54

AP009044.PE54        Location/Qualifiers
FT   CDS_pept        complement(59134..59274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_6002"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_6002"
FT                   /db_xref="EnsemblGenomes-Tr:BAQ21064"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B6VM91"
FT                   /protein_id="BAQ21064.1"
FT                   /translation="MFCTFHGSKTVLLLGGYDKGKDPSPKRQQKEIQRAQKQLTQWRKS
FT                   L"
     gtgttctgca cgtttcatgg atcaaaaacc gtgcttcttc tcggtggcta cgacaaagga        60
     aaagacccct ccccaaaacg ccaacaaaaa gaaattcagc gagcgcaaaa acaactcaca       120
     cagtggagaa agagcctctg a                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page