(data stored in ACNUC30630 zone)

EMBL: AP009044.PE556

AP009044.PE556       Location/Qualifiers
FT   CDS_pept        complement(585996..586946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0526"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0526"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53494"
FT                   /db_xref="GOA:A4QB97"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017655"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QB97"
FT                   /protein_id="BAF53494.1"
FT                   /translation="MARFSPQDLADHLKDGLLSFPATAFQDDLEVDEVAYVEHIEWQSS
FT                   YPVAGLFAAGGTGEGFSLTVEENHRVTQLAVQASSPEVPVLGSATGSTKSAIANAQGAE
FT                   AAGAEGVLLLPPYLTECDAEGLYNHAAAVCESTSLGVIVYNRANAIYSPEVIARLSERY
FT                   PNFIGFKDGTGNIEHLAKITTLCGDRLFYLGGLPTAETFALPLLQMGMSTYSSAMFNFI
FT                   PDFALSFYADVRAQDSAAVKQKLSDFVLPYLDIRDRAQGYGVSIVKGGLKAVGRNAGGV
FT                   RPPLRNLSEQDIADLSDLLATSGAGSYRLPVEVKA"
     atggcacgct tttcaccaca agatctcgca gaccacctca aggatggact gctctctttc        60
     ccagcaactg ctttccaaga tgacctcgaa gtagatgaag ttgcgtatgt cgagcacatt       120
     gaatggcagt ccagctaccc agtagctggc ctcttcgcag ctggcggtac tggcgaagga       180
     ttcagcctta ccgttgagga aaaccaccgt gtcactcaac ttgcagttca ggcatccagt       240
     ccggaggttc cggtgctggg atcggctact ggttcaacca aatctgccat cgccaacgcg       300
     caaggcgcag aggccgcagg cgcggaaggt gttctcctgc ttcctcccta cctcaccgaa       360
     tgcgatgcag aaggcttgta caatcacgca gccgcagtct gtgaatccac ctcccttggt       420
     gtcatcgtgt acaaccgcgc aaacgccatc tactcccctg aggttattgc ccgactctct       480
     gagcgctacc ccaacttcat cggattcaaa gatggcaccg gaaacatcga gcacctagca       540
     aagatcacga cattgtgcgg tgaccgcctg ttctacctgg gtggactgcc aaccgcagaa       600
     acctttgcac ttccgctgct tcagatgggc atgagcacct actcctctgc aatgttcaac       660
     ttcattcctg atttcgcact gagcttctac gctgatgttc gtgcgcagga cagcgcagca       720
     gtaaagcaga agctgagcga ttttgtgctc ccctacttgg atatccgcga tcgcgcacaa       780
     ggctacggtg tctccattgt taagggcgga ctcaaggctg ttggccgcaa cgctggcggc       840
     gttcgcccac cactgcgtaa cctctccgaa caagacattg cagatctctc cgacttgctc       900
     gccacctctg gcgcaggttc ttaccgcctt ccagttgagg tgaaagcatg a                951
//

If you have problems or comments...

PBIL Back to PBIL home page