(data stored in ACNUC30630 zone)

EMBL: AP009044.PE567

AP009044.PE567       Location/Qualifiers
FT   CDS_pept        593327..593443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_6026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_6026"
FT                   /db_xref="EnsemblGenomes-Tr:BAQ21088"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B6VK17"
FT                   /protein_id="BAQ21088.1"
FT                   /translation="MRWVHWWNTKRLHEALDYAILQVVETKCYLTQPINTGA"
     ttgcggtggg tgcattggtg gaacaccaag cggcttcatg aagcattgga ctacgccatc        60
     ctacaagtgg tagaaaccaa gtgctatctc acccagccca tcaacacagg ggcgtaa          117
//

If you have problems or comments...

PBIL Back to PBIL home page