(data stored in ACNUC30630 zone)

EMBL: AP009044.PE570

AP009044.PE570       Location/Qualifiers
FT   CDS_pept        complement(598201..598653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0537"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53505"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBA8"
FT                   /protein_id="BAF53505.1"
FT                   /translation="MRPTSGSATGGATSDLAITAGGQTLDFYLSPKRNVAAAKRFLAKT
FT                   LRSNTITGSPRVINTDKAPSLTRAIAELKSEGICPPTVEHRQVKYLNNILEGDHGRLKR
FT                   ILGPKVAFKNLDICISDVERDGGDALDSRKGQGTMFALTGNRTRTR"
     atgagaccta catccgggtc ggcgacaggt ggtgctacct ctgatctggc gatcaccgcc        60
     ggtgggcaga ccctggactt ttacctctct ccgaagcgga acgtggccgc agcgaagcgt       120
     ttcctggcca agaccctgag gtcgaacacg ataaccgggt cccctcgggt gatcaacacc       180
     gataaagcac cctccctgac cagggcaatc gccgagttga agtcagaggg aatctgcccg       240
     ccaacagtgg aacaccggca ggtgaaatac ctcaacaaca ttctggaagg cgaccatggt       300
     cggctgaagc ggatcctcgg gccgaaggtg gcgtttaaga acttagacat ctgcatatcg       360
     gacgttgaaa gggatggagg cgatgcactc gattcacgga aagggcaagg cacgatgttt       420
     gccctcacgg gcaaccgaac ccggacgcgg tga                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page