(data stored in ACNUC30630 zone)

EMBL: AP009044.PE58

AP009044.PE58        Location/Qualifiers
FT   CDS_pept        complement(63342..64766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0056"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53017"
FT                   /db_xref="GOA:A4Q9X4"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9X4"
FT                   /protein_id="BAF53017.1"
FT                   /translation="MNRSIRITSLFSLLLILVLVANLTWIQAFRDDDLAQNPLNARGFF
FT                   AAKSTPRGQISTGGQVLAESSQDNQGYYQRSYITNPTTYAPVVGYFSDVYGAAGLELGY
FT                   NSILNGSDSSLFTTQWLDVISGRPTHGANIELTLDPNAQQTAYEQLSQSGYEGAVVALR
FT                   PSTGEVLAMASSPSFDPNQIVNPATAEDAWAEYTSAEGAPLLNHATQESLPPGSIFKII
FT                   TTAAALENGYSADSTVTAEAAVTLPGTNTTLTNYGGQTCAGGGTTTLLTAFQLSCNTAF
FT                   VETGIDVGADALRASAEDFGVGQTYSLGLDNVPGGLGEIPDDAALGQSSIGQRDVQMNV
FT                   LQAAVMAGTVSNGGVRMEPYLVSRVTGQDLSELSTHKPKSVGGVEPEIAEQLKTLMEAS
FT                   ERNTSGYAGIQIASKTGTAEHGDENTPPHTWYVAFNNDIAVAVLVKDGGGFGTSATGGQ
FT                   VAAPIGRAVLQAAGGF"
     gtgaaccgct cgatccgaat cacatccctc ttctctttgc ttttgatctt ggtactcgtg        60
     gcaaacctca cctggattca ggcttttagg gacgatgatc ttgctcagaa tccactgaac       120
     gcacgtggtt tctttgccgc caaatccact ccccgtggcc agatttcaac tggcggccaa       180
     gtactcgcag agtcctccca ggacaatcag ggttactacc agcgcagcta catcaccaac       240
     ccgactacct acgcaccggt agttggttac ttctctgatg tgtatggcgc agccggcctg       300
     gaattgggat acaactcaat tctcaacggc agcgactctt ccctgtttac tacccagtgg       360
     ctggatgtca tctctggccg ccccacccac ggcgcaaaca ttgagctgac cttggatccc       420
     aatgcacagc aaactgctta tgagcagctg agccaaagtg gctacgaggg tgctgtggtg       480
     gcgcttcgcc caagcactgg cgaggtgctg gccatggcgt cgtcaccaag ctttgacccc       540
     aaccagatcg tgaacccagc aaccgctgag gacgcttggg ctgagtacac ctccgctgaa       600
     ggtgcaccgt tgctcaacca tgcaacgcag gaatcactgc ctcctggatc tattttcaag       660
     atcatcacta ctgccgcagc tttggagaac ggctactctg ctgattccac cgtgactgca       720
     gaagcagcag tgaccctgcc tggcaccaac accaccttga ccaactacgg cggtcagaca       780
     tgtgcaggcg gtggcaccac taccctgctc accgctttcc agctctcctg caacactgcg       840
     tttgtggaga ccggcattga tgttggcgcg gatgctctac gcgcgtctgc cgaggacttc       900
     ggagtgggcc aaacctacag cttgggactg gacaacgttc caggcggctt gggtgaaatc       960
     cctgacgatg cagctcttgg tcaatccagc attggccagc gcgacgtgca aatgaacgtg      1020
     ctacaggccg ctgtcatggc aggaaccgta tccaacggtg gcgtacgcat ggaaccatat      1080
     ttggtctccc gcgtcaccgg tcaggacctg agcgaactga gcacccacaa gccaaaatca      1140
     gttggtggag tcgaaccaga aattgcagaa cagttgaaga ctttgatgga agcctcagag      1200
     cgcaacacct caggctacgc cggaattcag attgcatcca agactggtac tgcagagcat      1260
     ggtgatgaaa acacaccacc acacacctgg tacgtggcat tcaacaacga cattgctgtt      1320
     gctgtgttgg tgaaagacgg cggtggattt ggcaccagtg caactggtgg tcaggtcgca      1380
     gccccaattg gccgagctgt gcttcaggca gccggaggat tttaa                      1425
//

If you have problems or comments...

PBIL Back to PBIL home page