(data stored in ACNUC30630 zone)

EMBL: AP009044.PE581

AP009044.PE581       Location/Qualifiers
FT   CDS_pept        complement(605301..606275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0546"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53514"
FT                   /db_xref="InterPro:IPR025159"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBB7"
FT                   /protein_id="BAF53514.1"
FT                   /translation="MRIEEIATLASDQNGLFTTAQAARLEVDRVTLHRAARNGVVRSIR
FT                   HGVYIFESAPFSPDEELRAAWLSLDPSRTVAERLQTPEQIVICTTSAAQQYGIGDFDTP
FT                   QHEFYSAQRKQTRADDIRLRIRTLDNEDIEIRDGLPLTTPTRIILDLLEERHDLVHISR
FT                   LIADAARKGLKVEWSRLATHAHKFAGDYQLTDDGLLQALAESSESTSDTAMAALSMLES
FT                   SSHLNDLFNKDLANLVGGFSKHLTIQMPEIPDLAAQLSRVQLPDIADQIPDLGFLPNVH
FT                   SQIHDYLHHDNAVNFTKDSHTSTNKKEMRNTSNEQEKPRTTQL"
     atgaggattg aagaaatcgc aacccttgct agtgaccaaa acggactgtt cactaccgct        60
     caggcagctc gcctagaagt cgaccgagtg acccttcacc gagcagctcg caacggcgtg       120
     gtgcgcagca tccgccacgg agtgtatatc ttcgagtccg ccccgttctc ccctgatgaa       180
     gaacttcgcg cggcctggct ctcactcgac ccctcacgaa cagttgcaga aagactgcag       240
     acccctgagc aaatcgtcat atgcaccacc tcggctgccc aacaatatgg aatcggcgac       300
     tttgacactc cacaacacga gttttacagc gcacaacgga aacaaacccg agcagacgac       360
     atccgactcc ggatccgcac actcgacaac gaagacatag aaattagaga cggcctacca       420
     ctgaccacac caacacgtat catcctcgac ctgctagaag agcgtcatga cctggtacat       480
     atcagccgtc tcattgccga tgccgcccgc aaaggactaa aagtggagtg gtccagacta       540
     gctacgcatg ctcataagtt cgctggagac taccagctca ctgatgacgg tctcctccag       600
     gcactcgccg agtcctccga atcgacctcc gatacagcta tggcagcact gtccatgctc       660
     gaaagcagtt cgcaccttaa tgatctgttc aacaaagatc tggcaaacct cgtcggaggc       720
     ttcagcaaac acctgactat tcagatgcct gagattcctg atcttgctgc acagctaagt       780
     agggtacagc tgcctgatat tgctgatcag atccctgatc ttggcttcct gccgaatgtt       840
     cactcccaga ttcatgacta cctacaccac gacaacgccg tcaatttcac aaaagattca       900
     cacacatcca caaataaaaa agaaatgaga aacacgtcca atgagcaaga aaagccaaga       960
     accacgcaac tatag                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page