(data stored in ACNUC30630 zone)

EMBL: AP009044.PE591

AP009044.PE591       Location/Qualifiers
FT   CDS_pept        614499..614759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0555"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53523"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBC6"
FT                   /protein_id="BAF53523.1"
FT                   /translation="MTFTTKYQNWPEASVVDLSDIALEGDALDAASVLTPVVGFLRLLE
FT                   GLDLDASRDWRATADELENVINDLRDLAADMLARQQQEELR"
     atgactttca cgacgaagta ccagaattgg cctgaagcct cagtagtgga tctttcagat        60
     atcgccctgg aaggcgacgc actcgatgcc gcaagcgtcc tgactccggt agtgggtttt       120
     ctccggctgc tggagggact ggatctagac gcatcgagag attggcgcgc gacggccgac       180
     gagctggaaa acgtcattaa tgatttacgc gacctagccg cggatatgct cgcccggcag       240
     caacaggagg agctgcgcta g                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page